Rv2491 Family assigned · medium auto-curated

H37Rv Rv2491 · MTBC0 mtbc0_002653 · 207 aa · 2829555–2830178 (+) · RefSeq NP_217007.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR00725 family protein
Revised (this work)TIGR00725 family protein. Pfam: LDcluster4 (PF18306.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XEF6 TrEMBL · unreviewed · Predicted
UniProt nameTIGR00725 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptioncytokinin biosynthetic process
Orthologous groupCOG1611
EC number EC 3.2.2.10
KEGG orthology K06966
KEGG pathways map00230, map00240

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.006 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (292) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LDcluster4PF18306.7 1.4e-3827–152 SLOG cluster4 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC38 (ribonuclease VapC38), medium confidence from genomic context alone (score 619 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2492 hyp hypothetical protein 967 967 ctx neighborhood:882 coexpression:731
Rv2494 vapC38 ribonuclease VapC38 619 619 ctx neighborhood:619
Rv2493 vapB38 antitoxin VapB38 619 619 ctx neighborhood:619
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 430 431 coexpression:413
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 426 427 coexpression:409
Rv3048c nrdF2 ribonucleoside-diphosphate reductase subunit beta NrdF2 418 418 coexpression:408
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 417 418 coexpression:407
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 416 417 coexpression:406
Rv1094 desA2 acyl-ACP desaturase DesA 408 408 coexpression:402
Rv0824c desA1 acyl-ACP desaturase DesA 406 406 coexpression:400
Rv3846 sodA superoxide dismutase 403 92
Rv0808 purF amidophosphoribosyltransferase 820 85 textmining:812
Rv2883c pyrH uridylate kinase 656 47 textmining:654
Rv1205 log hyp hypothetical protein 809 44 textmining:809
Rv2017 transcriptional regulator 631 44 textmining:630

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TIGR00725 family protein
  • Pfam (hmmscan --cut_ga): LDcluster4 PF18306.7 (E=1e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217007.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LDcluster4 (PF18306.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1611
  • Curated reference: UniProt I6XEF6 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor vapC38
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002653|Rv2491|
MVDTSAPASRLDTDPRRAHVSLSKHPYQIGVFGSGTIGPRVYELAYQVGAEIAKQGHILISGGMTGTMEASSRGASDADGLVVGVLPGDKFTDGNAYSTIKILSGMQFARNYITGLSCHGAIVVGGSSGAYEEARRVWEGRGPVVVLANSGSPTGASAQMLSMQEIFGVAFPEDKPKPWRVFSAATPAESVSLVIGLIRKGYAQHEP