Rv2308a Family assigned · medium

H37Rv Rv2308a · MTBC0 - · 110 aa · 2581145–2581477 (+) · RefSeq YP_009030038.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)3'-5' exonuclease of the DEDDh / RNase-T superfamily (Mut-7-like exoribonuclease fold); nuclease activity RefSeq leaves this locus uncharacterised.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2CC52

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.19 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 44.1 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1zud-assembly3_1 0.08 0.55 2.6e+00 1zud-assembly3_1 Structure of ThiS-ThiF protein complex
2i22-assembly1_A 0.08 0.50 5.9e+00 2i22-assembly1_A Crystal structure of Escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate
6yub-assembly1_A 0.05 0.45 4.6e+00 6yub-assembly1_A Crystal structure of Uba4 from Chaetomium thermophilum
7u58-assembly1_B 0.05 0.48 4.0e+00 7u58-assembly1_B YcaO-mediated ATP-dependent peptidase activity in ribosomal peptide biosynthesis
7u58-assembly1_A 0.05 0.49 4.0e+00 7u58-assembly1_A YcaO-mediated ATP-dependent peptidase activity in ribosomal peptide biosynthesis
5gaj-assembly1_A 0.04 0.35 4.0e+00 5gaj-assembly1_A Solution NMR structure of De novo designed PLOOP2X3_50 fold protein, Northeast Structural Genomics Consortium (NESG) target OR258
1prx-assembly1_B 0.02 0.41 9.8e+00 1prx-assembly1_B HORF6 A NOVEL HUMAN PEROXIDASE ENZYME
8oif-assembly1_A 0.02 0.41 8.6e+00 8oif-assembly1_A Structure of the UBE1L activating enzyme bound to ISG15 and UBE2L6

Evidence

  • HHpred (Neff 9.09): top hit 8Q66_A Mut-7 exonuclease Prob 98.8%, E 1.7e-8, 93 aligned cols; corroborated by RNase P (PRORP metallonuclease) and PIN-domain nuclease hits; strong purifying
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030038.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CC52
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 44.1, very low)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2308a|
MLEVDKVTHVVDENLLRLGVALSPSEKTRPGLAARPSTTCYRKASSTPTGSPSSGVGWVVISNDRHLRTRPVEAELAVAHKLKVVHLHGRVGGLVRVGTADAAGCAVAGH