Rv2307B Still unknown · low auto-curated

H37Rv Rv2307B · MTBC0 - · 143 aa · 2579504–2579935 (-) · RefSeq YP_177666.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 2mf6-assembly1_C Solution NMR structure of Chimeric Avidin, ChiAVD(I11 (prob 0.28, TM 0.63).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FG2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameHypothetical glycine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2A57W

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.64% of strains (932) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 57.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2mf6-assembly1_C 0.28 0.63 1.9e+00 2mf6-assembly1_C Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form
2cam-assembly1_B-2 0.18 0.47 1.2e+00 2cam-assembly1_B-2 AVIDIN MUTANT (K3E,K9E,R26D,R124L)
3mm0-assembly3_I-2 0.10 0.61 7.6e+00 3mm0-assembly3_I-2 Crystal structure of chimeric avidin
2p3p-assembly1_A 0.06 0.49 5.6e+00 2p3p-assembly1_A Structure of a domain of an uncharacterized protein PG_1388 from Porphyromonas gingivalis W83
7zn1-assembly1_C 0.06 0.46 5.6e+00 7zn1-assembly1_C Avidin + Biotin-Tempo
2c4i-assembly1_A-2 0.06 0.45 5.6e+00 2c4i-assembly1_A-2 Crystal structure of engineered avidin
2avi-assembly1_A 0.04 0.42 4.7e+00 2avi-assembly1_A THREE-DIMENSIONAL STRUCTURES OF AVIDIN AND THE AVIDIN-BIOTIN COMPLEX
1rav-assembly1_A 0.04 0.44 5.0e+00 1rav-assembly1_A RECOMBINANT AVIDIN

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2307A hyp hypothetical protein 572 572 ctx neighborhood:558
Rv2307D hyp hypothetical protein 557 557 ctx neighborhood:546

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 2mf6-assembly1_C Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in th (prob 0.28, E=2e+00, TM=0.63)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177666.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A57W
  • Curated reference: UniProt Q79FG2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 57.7, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2307B|
MEEVPTGPPAMGHRACGGQKAAFPTRMNSGVEKMYKNSIAIAIGTLTMAVEFSMVSANAEPAPPPGQDPHMPNSAMGYCPGGGFGGITGWGYCDGIRYPDGSYWHQVRVPAPFVGTTLTLSCVIDDGSPVPPLAAPGSCGGGA