Rv2085 Still unknown · low auto-curated

H37Rv Rv2085 · MTBC0 - · 101 aa · 2343027–2343332 (+) · RefSeq NP_216601.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLJ9 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2085

UniProt still lists this protein as Uncharacterized protein Rv2085; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptiontransposase activity
Orthologous groupCOG2963

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.334 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (188) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2087 (Rv2087, (MTCY49.27), len: 76 aa. Conserved hypothetical protein, similar to but shorter than transposases, but we can find no sequence error), high confidence from genomic context alone (score 834 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2086 hyp hypothetical protein 945 942 ctx neighborhood:781 cooccurence:716
Rv2087 Rv2087, (MTCY49.27), len: 76 aa. Conserved hypothetical protein, similar to but shorter than transposases, but we can find no sequence error 834 834 ctx neighborhood:584 cooccurence:588
Rv2082 hyp hypothetical protein 795 796 ctx neighborhood:552 cooccurence:559
Rv2084 hyp hypothetical protein 572 572 ctx neighborhood:552
Rv2083 hyp hypothetical protein 571 572 ctx neighborhood:552
Rv2942 mmpL7 transmembrane transport protein MmpL7 512 513 ctx cooccurence:507
Rv3899c hyp hypothetical protein 506 506 ctx cooccurence:502
Rv3350c PPE56 PPE family protein PPE56 480 480 ctx cooccurence:477
Rv3347c PPE55 PPE family protein PPE55 469 469 ctx cooccurence:466
Rv0355c PPE8 PPE family protein PPE8 466 466 ctx cooccurence:463
Rv3349c transposase 461 462 ctx cooccurence:452
Rv1749c integral membrane protein 457 457 ctx cooccurence:457
Rv3343c PPE54 PPE family protein PPE54 456 457 ctx cooccurence:454
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 453 453 ctx cooccurence:453
Rv1885c chorismate mutase 449 449 ctx cooccurence:446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216601.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2963
  • Curated reference: UniProt P9WLJ9 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 45.7, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor Rv2087
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2085|
MSDMCDVVSFVGAAERVLRARFRPSPESGPPVHARRCGWSLGISAETLRRWAGQAEVDSGVVAGVSASRSGSVKTSELEQTIEILKVATSFFARKCDPRHR