Rv2076c Family assigned · low

H37Rv Rv2076c · MTBC0 - · 83 aa · 2333037–2333288 (-) · RefSeq NP_216592.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Polytopic integral membrane protein with 3 predicted transmembrane helices (DeepTMHMM). RefSeq leaves it 'hypothetical protein'. A topological feature consistent with a membrane transporter/permease or membrane-embedded enzyme; the transported substrate and molecular function are undetermined.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLL3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2076c

UniProt still lists this protein as Uncharacterized protein Rv2076c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B3FH

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 50.9 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8e0m-assembly3_I 0.13 0.59 6.3e+00 8e0m-assembly3_I Homotrimeric variant of tcTRP9, BGL15
8e0m-assembly4_J 0.13 0.60 6.7e+00 8e0m-assembly4_J Homotrimeric variant of tcTRP9, BGL15
7tj9-assembly1_A 0.13 0.60 7.2e+00 7tj9-assembly1_A Cryo-EM structure of the human Nax channel in complex with beta3 solved in GDN
8f0r-assembly1_A 0.13 0.60 7.2e+00 8f0r-assembly1_A Structure of VSD4-NaV1.7-NaVPas channel chimera bound to the arylsulfonamide inhibitor GNE-3565
8f0p-assembly1_A 0.13 0.55 5.2e+00 8f0p-assembly1_A Structure of VSD4-NaV1.7-NaVPas channel chimera bound to the hybrid inhibitor GNE-1305
6xr2-assembly1_C 0.10 0.58 8.7e+00 6xr2-assembly1_C Computationally designed right-handed alpha/alpha homotrimeric toroid with 3 repeats per subunit
8f0s-assembly1_A 0.10 0.54 7.2e+00 8f0s-assembly1_A Structure of VSD4-NaV1.7-NaVPas channel chimera bound to the hybrid inhibitor GNE-9296
8e0m-assembly1_B 0.09 0.62 9.9e+00 8e0m-assembly1_B Homotrimeric variant of tcTRP9, BGL15

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2077c (transmembrane protein), high confidence from genomic context alone (score 767 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2077c transmembrane protein 767 767 ctx neighborhood:756
Rv2077A hyp hypothetical protein 676 677 ctx neighborhood:675
Rv2075c hyp hypothetical protein 478 478 ctx neighborhood:475

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • DeepTMHMM: 3 transmembrane helices (type TM)
  • Integral membrane topology (localisation feature, not a function)
  • DeepTMHMM topology prediction (project 'Still unknown gene function', phase8, 2026-06-10). A topological feature, not a demonstrated molecular function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216592.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B3FH
  • Curated reference: UniProt P9WLL3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 50.9, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor Rv2077c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2076c|
MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLLVLIPAVVYGKMRRSRRISSDQDR