PE_PGRS29 Family assigned · medium auto-curated
H37Rv Rv1468c · MTBC0 - ·
370 aa · 1655609–1656721 (-) ·
RefSeq YP_177814.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE-PGRS family protein PE_PGRS29 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE-PGRS family protein PE_PGRS29. Pfam: PE (PF00934.26), PGRS (PF21526.3). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FP0
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ubiquitin-binding protein Rv1468c |
| Curated function | Mediates direct binding of host ubiquitin (Ub) to the mycobacterial surface, which triggers host xenophagy. Interaction between Rv1468c and ubiquitin recruits autophagy receptor p62 to deliver mycobacteria into LC3-associated autophagosomes. It could be a viable evolutionary strategy adopted by M.tuberculosis to maintain long-term intracellular survival through self-controlling its intracellular bacterial loads to avoid excessive host inflammatory immune responses. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | COG3391 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.518 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 2.13% of strains (3087) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 1.5e-31 | 4–94 | PE family |
PGRS | PF21526.3 | 5.6e-13 | 118–185 | PGRS repeats |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadE15 (acyl-CoA dehydrogenase), medium confidence from genomic context alone (score 648 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1467c fadE15 |
acyl-CoA dehydrogenase | 648 | 648 ctx | neighborhood:648 |
Rv1469 ctpD |
cobalt/nickel-exporting P-type ATPase | 759 | 490 ctx | neighborhood:490 textmining:548 |
Rv1470 trxA |
thioredoxin TrxA | 421 | 421 ctx | neighborhood:421 |
Rv0198c zmp1 |
zinc metalloprotease | 407 | 407 | |
Rv1471 trxB1 |
thioredoxin | 406 | 406 ctx | neighborhood:406 |
Rv1754c hyp |
hypothetical protein | 495 | 159 | textmining:425 |
Rv1135c PPE16 |
PPE family protein PPE16 | 430 | 41 | textmining:430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS29
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-31), PGRS PF21526.3 (E=6e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177814.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3391 - Curated reference: UniProt Q79FP0 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
fadE15 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1468c|PE_PGRS29 MSFVVANTEFVSGAAGNLARLGSMISAANSAAAAQTTAVAAAGADEVSAAVAALFGAHGQTYQVLSAQAAAFHSQFVQALSGGAQAYAAAEATNFGPLQPLFDVINAPTLALLNRPLIGNGADGTAANPNGQAGGLLIGNGGNGFSPAAGPGGNGGAAGLLGHGGNGGVGALGANGGAGGTGGWLFGNGGAGGNSGGGGGAGGIGGSAVLFGAGGAGGISPNGMGAGGSGGNGGLFFGNGGAGASSFLGGGGAGGRAFLFGDGGAGGAALSAGSAGRGGDAGFFYGNGGAGGSGAGGASSAHGGAGGQAGLFGNGGEGGDGGALGGNGGNGGNAQLIGNGGDGGDGGGAGAPGLGGRGGLLLGLPGANGT