Rv0470A Still unknown · low auto-curated

H37Rv Rv0470A · MTBC0 - · 146 aa · 561854–562294 (-) · RefSeq YP_177622.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 6b87-assembly1_A-2 Crystal structure of transmembrane protein TMHC2_E (prob 0.13, TM 0.62).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N651 TrEMBL · unreviewed · Predicted
UniProt name1,4-dihydroxy-2-naphthoate prenyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
eggNOG descriptionBelongs to the MenA family. Type 1 subfamily
Orthologous groupCOG1575

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.517 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 5.77% of strains (8381) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 54.5 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6b87-assembly1_A-2 0.13 0.62 9.5e+00 6b87-assembly1_A-2 Crystal structure of transmembrane protein TMHC2_E
2dnx-assembly1_A 0.06 0.39 7.6e+00 2dnx-assembly1_A Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0472c (HTH-type transcriptional regulator), high confidence from genomic context alone (score 801 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0471c hyp hypothetical protein 834 834 ctx neighborhood:781
Rv0472c HTH-type transcriptional regulator 801 801 ctx neighborhood:800
Rv0355c PPE8 PPE family protein PPE8 712 713 ctx cooccurence:708
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 706 706 ctx cooccurence:706
Rv3347c PPE55 PPE family protein PPE55 705 705 ctx cooccurence:702
Rv3350c PPE56 PPE family protein PPE56 704 704 ctx cooccurence:702
Rv2209 integral membrane protein 703 703 ctx cooccurence:699
Rv1004c membrane protein 701 701 ctx cooccurence:696
Rv0341 iniB isoniazid inducible protein IniB 694 695 ctx cooccurence:685
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 690 690 ctx cooccurence:690
Rv0304c PPE5 PPE family protein PPE5 684 685 ctx cooccurence:681
Rv2819c csm5 CRISPR type III-associated RAMP protein Csm5 683 684 ctx cooccurence:682
Rv3343c PPE54 PPE family protein PPE54 683 683 ctx cooccurence:679
Rv1917c PPE34 PPE family protein PPE34 678 678 ctx cooccurence:674
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 676 676 ctx cooccurence:676

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 6b87-assembly1_A-2 Crystal structure of transmembrane protein TMHC2_E (prob 0.13, E=1e+01, TM=0.62)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177622.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1575
  • Curated reference: UniProt L7N651 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 54.5, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor Rv0472c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0470A|
MGAGGWEVVLASLPYGLLCTTVLMGKHIDKIGYDEPLGIRTLPVLLGETCARTVTLAMMVGFYLLIAVNVMLAAMPWPRCWSPGRCPGWRKCGPISCDGGPSSRHRRFRCGRCGMPRWPGCTCVRPVRCWLWAWRSVPGGAPGDFR