Rv0397A Still unknown · low auto-curated

H37Rv Rv0397A · MTBC0 - · 82 aa · 476394–476642 (+) · RefSeq YP_004837048.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7cjt-assembly1_D Crystal Structure of SETDB1 Tudor domain in complexed (prob 0.14, TM 0.67).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6Y3N9 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BB0I

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.634 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 58.5 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7cjt-assembly1_D 0.14 0.67 3.4e+00 7cjt-assembly1_D Crystal Structure of SETDB1 Tudor domain in complexed with (R,R)-59
3prb-assembly1_A 0.08 0.56 6.3e+00 3prb-assembly1_A Structural analysis of protein folding by the Methanococcus jannaschii chaperone FKBP26
7n6g-assembly1_6N 0.07 0.39 3.4e+00 7n6g-assembly1_6N C1 of central pair
1u4p-assembly1_B 0.06 0.31 1.8e+00 1u4p-assembly1_B Crystal Structure of human RANTES mutant K45E
3pra-assembly1_B 0.06 0.47 4.5e+00 3pra-assembly1_B Structural analysis of protein folding by the Methanococcus jannaschii chaperone FKBP26
6wzm-assembly1_E 0.06 0.40 4.5e+00 6wzm-assembly1_E LY3041658 Fab bound to CXCL8
6vgj-assembly3_C 0.06 0.39 3.9e+00 6vgj-assembly3_C N-terminal variant of CXCL13
5cba-assembly1_E 0.05 0.40 5.1e+00 5cba-assembly1_E 3B4 in complex with CXCL13 - 3B4-CXCL13

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0397 hyp hypothetical protein 469 469 ctx neighborhood:469
Rv0455c hyp hypothetical protein 461 461 ctx neighborhood:461

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 7cjt-assembly1_D Crystal Structure of SETDB1 Tudor domain in complexed with (R,R (prob 0.14, E=3e+00, TM=0.67)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837048.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BB0I
  • Curated reference: UniProt I6Y3N9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 58.5, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0397A|
MHALRLVGLAILTAIAPIAVLIGSSPAHADTDIGQPCSPEGAKLWGNPGPIYCERTADGQLQWVSIPAWALCVAFCDRPGGP