PE5 Family assigned · medium auto-curated
H37Rv Rv0285 · MTBC0 - ·
102 aa · 349624–349932 (+) ·
RefSeq YP_177710.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE5 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE5. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N695
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE family immunomodulator PE5 |
| Curated function | Important for the siderophore-mediated iron-acquisition function of ESX-3. May play a pivotal role in the evasion of host immune response by M.tuberculosis. Mediates production of IL-10 via activation of the p38 and ERK1/2 mitogen-activated protein kinase (MAPK) signaling pathways. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Cell motility protein |
| Orthologous group | 2B7DA |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 1.5e-20 | 3–93 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: eccB3 (ESX-3 secretion system protein EccB3), high confidence from genomic context alone (score 882 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0283 eccB3 |
ESX-3 secretion system protein EccB3 | 924 | 882 ctx | neighborhood:882 |
Rv0282 eccA3 |
ESX-3 secretion system protein EccA | 894 | 882 ctx | neighborhood:882 |
Rv0284 eccC3 |
ESX-3 secretion system protein EccC3 | 881 | 881 ctx | neighborhood:881 |
Rv0286 PPE4 |
PPE family protein PPE4 | 990 | 801 ctx | neighborhood:801 textmining:954 |
Rv0287 esxG |
ESAT-6 like protein EsxG | 912 | 663 ctx | neighborhood:663 textmining:752 |
Rv0289 espG3 |
ESX-3 secretion-associated protein EspG3 | 715 | 597 ctx | neighborhood:597 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 671 | 579 ctx | neighborhood:579 |
Rv0288 esxH |
ESAT-6-like protein EsxH | 854 | 578 ctx | neighborhood:578 textmining:669 |
Rv0291 mycP3 |
membrane-anchored mycosin MycP | 547 | 526 ctx | neighborhood:526 |
Rv0292 eccE3 |
ESX-3 secretion system protein EccE | 560 | 509 ctx | neighborhood:509 |
Rv0281 |
S-adenosylmethionine-dependent methyltransferase | 490 | 490 ctx | neighborhood:490 |
Rv0280 PPE3 |
PPE family protein PPE3 | 450 | 416 ctx | neighborhood:416 |
Rv2123 PPE37 |
PPE family protein PPE37 | 843 | 155 | textmining:823 |
Rv1387 PPE20 |
PPE family protein PPE20 | 581 | 71 | textmining:568 |
Rv3873 PPE68 |
PPE family protein PPE68 | 656 | 54 | textmining:652 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE5
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=2e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177710.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B7DA - Curated reference: UniProt L7N695 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
eccB3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0285|PE5 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG