Rv2799 Family assigned · low auto-curated
H37Rv Rv2799 · MTBC0 - ·
209 aa · 3107768–3108397 (+) ·
RefSeq NP_217315.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Membrane protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6XFB7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2AK6C |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.251 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 8 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2800 (hydrolase), high confidence from genomic context alone (score 793 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2800 |
hydrolase | 793 | 793 ctx | neighborhood:787 |
Rv2793c truB |
tRNA pseudouridine synthase B | 692 | 692 ctx | neighborhood:691 |
Rv2794c pptT |
4'-phosphopantetheinyl transferase | 692 | 692 ctx | neighborhood:691 |
Rv2795c hyp |
hypothetical protein | 691 | 691 ctx | neighborhood:691 |
Rv2798c hyp |
hypothetical protein | 658 | 658 ctx | neighborhood:653 |
Rv2797c hyp |
hypothetical protein | 655 | 655 ctx | neighborhood:653 |
Rv2790c ltp1 |
lipid-transfer protein | 629 | 629 ctx | neighborhood:628 |
Rv2796c lppV |
lipoprotein LppV | 592 | 592 ctx | neighborhood:589 |
Rv3491 hyp |
hypothetical protein | 873 | 70 | textmining:870 |
Rv0175 |
Mce associated membrane protein | 688 | 68 | textmining:679 |
Rv1887 hyp |
hypothetical protein | 807 | 55 | textmining:805 |
Rv1860 apa hyp |
hypothetical protein | 515 | 50 | textmining:511 |
Rv2164c hyp |
hypothetical protein | 870 | 46 | textmining:870 |
Rv3835 hyp |
hypothetical protein | 807 | 46 | textmining:806 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 550 | 46 | textmining:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217315.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AK6C - Curated reference: UniProt I6XFB7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
Rv2800 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2799| MYTPGKGPPRAGGVVFTRVRLIGGLGALTAAVVVVGTVGWQGIPPAPTGGDAVQLRSTAAPMSTTMKSPIVATTDPSPFDPCRDIPFDVIQRLGLAYTPPEAEEGLRCHFDAGNYQMAVEPIIWRTYAQTLPPDAIETTIAGHRAAQYWVRKPTYHNSFWYSSCMVTFKTSYGVIQQSLFYSTVYSEPDVDCPSTNLQRANDLVPYYRF