Rv2799 Family assigned · low auto-curated

H37Rv Rv2799 · MTBC0 - · 209 aa · 3107768–3108397 (+) · RefSeq NP_217315.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Membrane protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6XFB7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AK6C

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.251 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2800 (hydrolase), high confidence from genomic context alone (score 793 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2800 hydrolase 793 793 ctx neighborhood:787
Rv2793c truB tRNA pseudouridine synthase B 692 692 ctx neighborhood:691
Rv2794c pptT 4'-phosphopantetheinyl transferase 692 692 ctx neighborhood:691
Rv2795c hyp hypothetical protein 691 691 ctx neighborhood:691
Rv2798c hyp hypothetical protein 658 658 ctx neighborhood:653
Rv2797c hyp hypothetical protein 655 655 ctx neighborhood:653
Rv2790c ltp1 lipid-transfer protein 629 629 ctx neighborhood:628
Rv2796c lppV lipoprotein LppV 592 592 ctx neighborhood:589
Rv3491 hyp hypothetical protein 873 70 textmining:870
Rv0175 Mce associated membrane protein 688 68 textmining:679
Rv1887 hyp hypothetical protein 807 55 textmining:805
Rv1860 apa hyp hypothetical protein 515 50 textmining:511
Rv2164c hyp hypothetical protein 870 46 textmining:870
Rv3835 hyp hypothetical protein 807 46 textmining:806
Rv2744c 35kd_ag hyp hypothetical protein 550 46 textmining:548

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217315.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AK6C
  • Curated reference: UniProt I6XFB7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv2800
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2799|
MYTPGKGPPRAGGVVFTRVRLIGGLGALTAAVVVVGTVGWQGIPPAPTGGDAVQLRSTAAPMSTTMKSPIVATTDPSPFDPCRDIPFDVIQRLGLAYTPPEAEEGLRCHFDAGNYQMAVEPIIWRTYAQTLPPDAIETTIAGHRAAQYWVRKPTYHNSFWYSSCMVTFKTSYGVIQQSLFYSTVYSEPDVDCPSTNLQRANDLVPYYRF