pptT Resolved · high auto-curated
H37Rv Rv2794c · MTBC0 mtbc0_002973 ·
227 aa ·
3125672–3126355 MTBC0
(-) ·
RefSeq NP_217310.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 4'-phosphopantetheinyl transferase |
|---|---|
| MTBC0 PGAP re-annotation | 4'-phosphopantetheinyl transferase |
| Revised (this work) | 4'-phosphopantetheinyl transferase. Pfam: 4PPT_N (PF17837.7), ACPS (PF01648.26). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 19 publications
19 TB publications mention this gene. 19 publication(s) discuss this gene (17 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Thioquinazolinones as Antituberculosis Agents Targeting Phosphopantetheinyl Transferase. doi:10.1021/acs.jmedchem.5c00856 | 2025 |
| Structure-based design of Mycobacterium tuberculosis PptT-ACP complex inhibitors using derivative design and machine learning. doi:10.1007/s12223-025-01274-4 | 2026 |
| Discovery of 1,3-Disubstituted Pyrazole derivatives as Mycobacterium tuberculosis inhibitors. doi:10.1016/j.bmcl.2025.130156 | 2025 |
| Redirecting raltitrexed from cancer cell thymidylate synthase to Mycobacterium tuberculosis phosphopantetheinyl transferase. doi:10.1126/sciadv.adj6406 | 2024 |
| Mycobacterium tuberculosis PptT Inhibitors Based on Heterocyclic Replacements of Amidinoureas. doi:10.1021/acsmedchemlett.3c00162 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | truB (Rv2793c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -4.52 (95% CI -5.01 to -4.03). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Biosynthesis of fatty acids and lipids. Transfers the 4'-phosphopantetheine moiety from coenzyme A to a SER of acyl-carrier protein. Catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + APO-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ]. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2817c
· 99.6% identity |
|---|---|
| M. leprae |
ML1547c
· 79.7% identity |
| M. marinum |
MMAR_1916
· 83.7% identity |
| M. smegmatis |
MSMEG_2648
· 74.4% identity |
| M. orygis |
RJtmp_002881
· 99.6% identity |
| M. abscessus |
MAB_3117c
· 67.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O33336
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 4'-phosphopantetheinyl transferase PptT |
| EC (curated) |
EC 2.7.8.7
|
| Curated function | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Involved in post-translational modification of various type-I polyketide synthases required for the formation of both mycolic acids and lipid virulence factors. Acts on Pks13, Mas, PpsA, PpsB, PpsC and PpsD. Also acts on AcpM, the meromycolate extension acyl carrier protein. In addition, is involved in the activation of the acyl carrier protein MbtL and the nonribosomal peptides synthases MbtB and MbtE, which are involved in the biosynthesis of the siderophore mycobactin..; FUNCTION: Required for the r. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | pptA |
| eggNOG description | Belongs to the P-Pant transferase superfamily |
| Orthologous group | COG2977 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.188 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 15 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.118
· 35 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.118) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 80.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 54.1% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 9 in the ORF — 9 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain validated drug target
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv2794c_TetOn10.1 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.477 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
| Drug-target cross-reference | annotated mechanism-of-action target PptT: 1 reference compound(s) phenocopy its inhibition — chemically-validated druggable target |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 46.2 ppm · rank 1806/3519 (48.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 227 aa |
|---|---|
| Molecular weight | 24.7 kDa |
| Theoretical pI | 6.21 |
| GRAVY | 0.051 (hydrophobic) |
| Aliphatic index | 96.7 |
| Aromaticity | 0.075 |
| Instability index | 49.7 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
4PPT_N | PF17837.7 | 4.2e-26 | 36–102 | 4'-phosphopantetheinyl transferase N-terminal domain |
ACPS | PF01648.26 | 2.4e-12 | 110–186 | 4'-phosphopantetheinyl transferase superfamily |
Experimental structures (Protein Data Bank) 12 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4u89 |
X-ray diffraction | 1.4 Å | 100% |
7n8m |
X-ray diffraction | 1.57 Å | 100% |
4qjk |
X-ray diffraction | 1.59 Å | 100% |
7ed0 |
X-ray diffraction | 1.65 Å | 100% |
8qzh |
X-ray diffraction | 1.7 Å | 100% |
7n8e |
X-ray diffraction | 1.74 Å | 100% |
4qvh |
X-ray diffraction | 1.75 Å | 100% |
6ct5 |
X-ray diffraction | 1.75934602056 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (12 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4qvh-assembly1_A |
1.00 | 0.98 | 2.4e-48 sig | 4qvh-assembly1_A Crystal structure of the essential Mycobacterium tuberculosis phosphopantetheinyl transferase PptT, solved as a fusion protein with maltose binding protein |
8qzh-assembly1_A |
1.00 | 0.99 | 3.0e-48 sig | 8qzh-assembly1_A Crystal structure of apo-PptT from Mycobacterium tuberculosis |
8qzj-assembly1_A |
1.00 | 0.99 | 2.2e-47 sig | 8qzj-assembly1_A Crystal structure of PptT-ADP from Mycobacterium tuberculosis |
8gkf-assembly1_A |
1.00 | 0.99 | 3.7e-47 sig | 8gkf-assembly1_A Phosphopantetheinyl transferase PptT from Mycobacterium tuberculosis in complex with Raltitrexed. |
8gkf-assembly5_E |
1.00 | 0.99 | 1.9e-46 sig | 8gkf-assembly5_E Phosphopantetheinyl transferase PptT from Mycobacterium tuberculosis in complex with Raltitrexed. |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | truB (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2795c (- strand, -4 bp gap) |
| Predicted operon |
truB · pptT · Rv2795c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: truB (tRNA pseudouridine synthase B), high confidence from genomic context alone (score 906 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2795c hyp |
hypothetical protein | 992 | 946 ctx | neighborhood:882 textmining:870 |
Rv2793c truB |
tRNA pseudouridine synthase B | 906 | 906 ctx | neighborhood:882 |
Rv2383c mbtB |
phenyloxazoline synthase | 953 | 895 ctx | neighborhood:544 coexpression:780 textmining:578 |
Rv2790c ltp1 |
lipid-transfer protein | 721 | 716 ctx | neighborhood:712 |
Rv3800c pks13 |
polyketide synthase | 932 | 713 | coexpression:462 textmining:775 |
Rv2789c fadE21 |
acyl-CoA dehydrogenase FadE21 | 710 | 710 ctx | neighborhood:697 |
Rv2384 mbtA |
2,3-dihydroxybenzoate-AMP ligase | 785 | 708 | coexpression:684 |
Rv2799 |
membrane protein | 692 | 692 ctx | neighborhood:691 |
Rv1888A |
Rv1888A, len: 57 aa. Conserved hypothetical protein. Possibly continuation of Rv1889c, part of large family of Mycobacterium tuberculosis pr | 557 | 557 ctx | cooccurence:556 |
Rv2797c hyp |
hypothetical protein | 547 | 546 ctx | neighborhood:542 |
Rv2798c hyp |
hypothetical protein | 545 | 545 ctx | neighborhood:542 |
Rv2796c lppV |
lipoprotein LppV | 545 | 544 ctx | neighborhood:542 |
Rv2792c |
resolvase | 490 | 490 ctx | neighborhood:474 |
Rv2791c tnpB |
transposase | 490 | 490 ctx | neighborhood:474 |
Rv0101 nrp |
peptide synthetase Nrp | 538 | 482 | coexpression:412 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 4'-phosphopantetheinyl transferase
- MTBC0 PGAP product: 4'-phosphopantetheinyl transferase
- Pfam (hmmscan --cut_ga): 4PPT_N PF17837.7 (E=4e-26), ACPS PF01648.26 (E=2e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217310.1)
- Domains: Pfam-A via hmmscan --cut_ga — 4PPT_N (PF17837.7), ACPS (PF01648.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2977 - Curated reference: UniProt O33336 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
55 functional partner(s); context anchor
truB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002973|Rv2794c|pptT MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGVVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pptT? Email the maintainer — the message is pre-filled with this gene's details.