argB Resolved · high auto-curated
H37Rv Rv1654 · MTBC0 mtbc0_001763 ·
294 aa · 1879884–1880768 (+) ·
RefSeq NP_216170.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acetylglutamate kinase |
|---|---|
| MTBC0 PGAP re-annotation | acetylglutamate kinase |
| Revised (this work) | Acetylglutamate kinase. Pfam: AA_kinase (PF00696.34). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQ01
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Acetylglutamate kinase |
| EC (curated) |
EC 2.7.2.8
|
| Curated function | Catalyzes the ATP-dependent phosphorylation of N-acetyl-L-glutamate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | argB |
| eggNOG description | Belongs to the acetylglutamate kinase family. ArgB subfamily |
| Orthologous group | COG0548 |
| EC number |
EC 2.7.2.8
|
| KEGG orthology |
K00930
|
| KEGG pathways |
map00220, map01100, map01110, map01130, map01210, map01230
|
| KEGG modules |
M00028
|
| Gene Ontology (55) |
GO:0003674, GO:0003824, GO:0003991, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006525, GO:0006526 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.145 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AA_kinase | PF00696.34 | 1.8e-49 | 29–270 | Amino acid kinase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: argC (N-acetyl-gamma-glutamyl-phoshate reductase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1652 argC |
N-acetyl-gamma-glutamyl-phoshate reductase | 999 | 1000 ctx | neighborhood:882 fusion:611 cooccurence:764 coexpression:973 database:900 textmining:923 |
Rv1653 argJ |
bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase | 999 | 1000 ctx | neighborhood:881 fusion:463 cooccurence:770 coexpression:976 database:900 textmining:948 |
Rv1655 argD |
acetylornithine aminotransferase | 999 | 998 ctx | neighborhood:881 cooccurence:659 coexpression:954 textmining:950 |
Rv1656 argF |
ornithine carbamoyltransferase | 999 | 998 ctx | neighborhood:881 coexpression:976 textmining:929 |
Rv1658 argG |
argininosuccinate synthase | 999 | 996 ctx | neighborhood:857 coexpression:973 textmining:821 |
Rv1657 argR |
arginine repressor | 999 | 996 ctx | neighborhood:881 coexpression:968 textmining:931 |
Rv1659 argH |
argininosuccinate lyase | 997 | 988 ctx | neighborhood:783 coexpression:929 textmining:767 |
Rv2747 argA |
L-glutamate alpha-N-acetyltranferase | 960 | 939 | database:900 |
Rv2919c glnB |
nitrogen regulatory protein P-II | 952 | 938 | experimental:928 |
Rv0428c |
GCN5-like N-acetyltransferase | 914 | 905 | database:900 |
Rv2321c rocD2 |
Rv2321c, (MTCY3G12.13), len: 181 aa. Probable rocD2,ornithine aminotransferase, highly similar to C-terminal region of other ornithine amino | 831 | 762 | coexpression:683 |
Rv2322c rocD1 |
Rv2322c, (MTCY3G12.12), len: 221 aa. Probable rocD1,ornithine aminotransferase, highly similar to N-terminal region of other ornithine amino | 817 | 744 | coexpression:684 |
Rv1213 glgC |
glucose-1-phosphate adenylyltransferase | 779 | 712 | coexpression:688 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 832 | 690 | coexpression:664 textmining:481 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 722 | 680 | coexpression:654 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acetylglutamate kinase
- MTBC0 PGAP product: acetylglutamate kinase
- Pfam (hmmscan --cut_ga): AA_kinase PF00696.34 (E=2e-49)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216170.1)
- Domains: Pfam-A via hmmscan --cut_ga — AA_kinase (PF00696.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0548 - Curated reference: UniProt P9WQ01 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
50 functional partner(s); context anchor
argC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001763|Rv1654|argB MSRIEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLESGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRG