argB Resolved · high auto-curated

H37Rv Rv1654 · MTBC0 mtbc0_001763 · 294 aa · 1879884–1880768 (+) · RefSeq NP_216170.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acetylglutamate kinase
MTBC0 PGAP re-annotationacetylglutamate kinase
Revised (this work)Acetylglutamate kinase. Pfam: AA_kinase (PF00696.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQ01 SwissProt · reviewed · Evidence at protein level
UniProt nameAcetylglutamate kinase
EC (curated) EC 2.7.2.8
Curated functionCatalyzes the ATP-dependent phosphorylation of N-acetyl-L-glutamate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameargB
eggNOG descriptionBelongs to the acetylglutamate kinase family. ArgB subfamily
Orthologous groupCOG0548
EC number EC 2.7.2.8
KEGG orthology K00930
KEGG pathways map00220, map01100, map01110, map01130, map01210, map01230
KEGG modules M00028
Gene Ontology (55) GO:0003674, GO:0003824, GO:0003991, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006525, GO:0006526 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.145 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AA_kinasePF00696.34 1.8e-4929–270 Amino acid kinase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: argC (N-acetyl-gamma-glutamyl-phoshate reductase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1652 argC N-acetyl-gamma-glutamyl-phoshate reductase 999 1000 ctx neighborhood:882 fusion:611 cooccurence:764 coexpression:973 database:900 textmining:923
Rv1653 argJ bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase 999 1000 ctx neighborhood:881 fusion:463 cooccurence:770 coexpression:976 database:900 textmining:948
Rv1655 argD acetylornithine aminotransferase 999 998 ctx neighborhood:881 cooccurence:659 coexpression:954 textmining:950
Rv1656 argF ornithine carbamoyltransferase 999 998 ctx neighborhood:881 coexpression:976 textmining:929
Rv1658 argG argininosuccinate synthase 999 996 ctx neighborhood:857 coexpression:973 textmining:821
Rv1657 argR arginine repressor 999 996 ctx neighborhood:881 coexpression:968 textmining:931
Rv1659 argH argininosuccinate lyase 997 988 ctx neighborhood:783 coexpression:929 textmining:767
Rv2747 argA L-glutamate alpha-N-acetyltranferase 960 939 database:900
Rv2919c glnB nitrogen regulatory protein P-II 952 938 experimental:928
Rv0428c GCN5-like N-acetyltransferase 914 905 database:900
Rv2321c rocD2 Rv2321c, (MTCY3G12.13), len: 181 aa. Probable rocD2,ornithine aminotransferase, highly similar to C-terminal region of other ornithine amino 831 762 coexpression:683
Rv2322c rocD1 Rv2322c, (MTCY3G12.12), len: 221 aa. Probable rocD1,ornithine aminotransferase, highly similar to N-terminal region of other ornithine amino 817 744 coexpression:684
Rv1213 glgC glucose-1-phosphate adenylyltransferase 779 712 coexpression:688
Rv1384 carB carbamoyl-phosphate synthase large subunit 832 690 coexpression:664 textmining:481
Rv1383 carA carbamoyl-phosphate synthase small subunit 722 680 coexpression:654

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acetylglutamate kinase
  • MTBC0 PGAP product: acetylglutamate kinase
  • Pfam (hmmscan --cut_ga): AA_kinase PF00696.34 (E=2e-49)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216170.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AA_kinase (PF00696.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0548
  • Curated reference: UniProt P9WQ01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor argC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001763|Rv1654|argB
MSRIEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLESGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRG