Rv0997a Still unknown · low auto-curated
H37Rv Rv0997a · MTBC0 - ·
83 aa · 1113861–1114112 (+) ·
RefSeq YP_009030028.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 1ueb-assembly2_B Crystal structure of translation elongation factor P (prob 1.00, TM 0.70). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2BTRF |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 84.7 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
1ueb-assembly2_B |
1.00 | 0.70 | 8.7e-02 | 1ueb-assembly2_B Crystal structure of translation elongation factor P from Thermus thermophilus HB8 |
6q84-assembly1_C |
1.00 | 0.70 | 1.1e-01 | 6q84-assembly1_C Crystal structure of RanGTP-Pdr6-eIF5A export complex |
8t2x-assembly1_eI |
1.00 | 0.70 | 9.7e-02 | 8t2x-assembly1_eI Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, A-site tRNA, messenger RNA and eIF5A, PRE |
1ueb-assembly1_A |
1.00 | 0.71 | 1.0e-01 | 1ueb-assembly1_A Crystal structure of translation elongation factor P from Thermus thermophilus HB8 |
6s8z-assembly1_A |
1.00 | 0.70 | 6.3e-02 | 6s8z-assembly1_A Elongation Factor P from Corynebacterium glutamicum |
1bkb-assembly1_A |
1.00 | 0.60 | 5.0e-02 | 1bkb-assembly1_A INITIATION FACTOR 5A FROM ARCHEBACTERIUM PYROBACULUM AEROPHILUM |
7oyc-assembly1_11 |
1.00 | 0.66 | 7.8e-02 | 7oyc-assembly1_11 Cryo-EM structure of the Xenopus egg 80S ribosome |
8g5y-assembly1_5A |
1.00 | 0.67 | 8.2e-02 | 8g5y-assembly1_5A mRNA decoding in human is kinetically and structurally distinct from bacteria (IC state) |
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 1ueb-assembly2_B Crystal structure of translation elongation factor P from Therm (prob 1.00, E=9e-02, TM=0.70)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030028.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BTRF - Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 84.7, confident)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0997a| MSTKYYLQKVPVEAVQPGFSLAIPHDGDYRLFQVDCTQMCQRSGQPVMIRLMSESVDGGQPWVLEYEAGTAVIRLLGVCQAAS