Rv0997a Still unknown · low auto-curated

H37Rv Rv0997a · MTBC0 - · 83 aa · 1113861–1114112 (+) · RefSeq YP_009030028.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 1ueb-assembly2_B Crystal structure of translation elongation factor P (prob 1.00, TM 0.70).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BTRF

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1ueb-assembly2_B 1.00 0.70 8.7e-02 1ueb-assembly2_B Crystal structure of translation elongation factor P from Thermus thermophilus HB8
6q84-assembly1_C 1.00 0.70 1.1e-01 6q84-assembly1_C Crystal structure of RanGTP-Pdr6-eIF5A export complex
8t2x-assembly1_eI 1.00 0.70 9.7e-02 8t2x-assembly1_eI Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, A-site tRNA, messenger RNA and eIF5A, PRE
1ueb-assembly1_A 1.00 0.71 1.0e-01 1ueb-assembly1_A Crystal structure of translation elongation factor P from Thermus thermophilus HB8
6s8z-assembly1_A 1.00 0.70 6.3e-02 6s8z-assembly1_A Elongation Factor P from Corynebacterium glutamicum
1bkb-assembly1_A 1.00 0.60 5.0e-02 1bkb-assembly1_A INITIATION FACTOR 5A FROM ARCHEBACTERIUM PYROBACULUM AEROPHILUM
7oyc-assembly1_11 1.00 0.66 7.8e-02 7oyc-assembly1_11 Cryo-EM structure of the Xenopus egg 80S ribosome
8g5y-assembly1_5A 1.00 0.67 8.2e-02 8g5y-assembly1_5A mRNA decoding in human is kinetically and structurally distinct from bacteria (IC state)

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 1ueb-assembly2_B Crystal structure of translation elongation factor P from Therm (prob 1.00, E=9e-02, TM=0.70)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030028.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BTRF
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.7, confident)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0997a|
MSTKYYLQKVPVEAVQPGFSLAIPHDGDYRLFQVDCTQMCQRSGQPVMIRLMSESVDGGQPWVLEYEAGTAVIRLLGVCQAAS