Rv0745 Still unknown · low auto-curated
H37Rv Rv0745 · MTBC0 - ·
175 aa · 835154–835681 (+) ·
RefSeq NP_215259.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6X9N8
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | ATP-dependent DNA helicase (RecQ) |
| Orthologous group | COG0514 |
| EC number |
EC 3.6.4.12
|
| KEGG orthology |
K03654, K03657, K06877
|
| KEGG pathways |
map03018, map03420, map03430
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.786 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (377) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE_PGRS9 (PE-PGRS family protein PE_PGRS9), high confidence from genomic context alone (score 723 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2810c |
Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for | 805 | 805 | coexpression:774 |
Rv2891 hyp |
hypothetical protein | 798 | 798 | coexpression:798 |
Rv0648 |
alpha-mannosidase | 793 | 793 | coexpression:793 |
Rv3446c hyp |
hypothetical protein | 760 | 760 | coexpression:651 |
Rv3447c eccC4 |
ESX-4 secretion system protein EccC4 | 735 | 735 | coexpression:735 |
Rv0620 galK |
galactokinase | 731 | 731 | coexpression:731 |
Rv0746 PE_PGRS9 |
PE-PGRS family protein PE_PGRS9 | 723 | 723 ctx | neighborhood:723 |
Rv1004c |
membrane protein | 667 | 667 ctx | cooccurence:663 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 656 | 656 ctx | cooccurence:656 |
Rv0304c PPE5 |
PPE family protein PPE5 | 653 | 653 ctx | cooccurence:650 |
Rv0341 iniB |
isoniazid inducible protein IniB | 650 | 650 ctx | cooccurence:649 |
Rv3350c PPE56 |
PPE family protein PPE56 | 648 | 648 ctx | cooccurence:646 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 644 | 644 ctx | cooccurence:644 |
Rv3347c PPE55 |
PPE family protein PPE55 | 644 | 644 ctx | cooccurence:642 |
Rv0355c PPE8 |
PPE family protein PPE8 | 636 | 637 ctx | cooccurence:635 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215259.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0514 - Curated reference: UniProt I6X9N8 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 35.6, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
PE_PGRS9 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0745| MGPPHRSRPPLPSPGPTCQVLPTTAVIHTVTAEALGRIGIDAPRIPGSLDVAAHAAIGLLPLVAGCDRRHRRPVRGARAGRAAQVSLCMTAIRVEPVSSNAVCTGPAAQVGDQSRSPQRDYAHQALQPDVPRRRARRHRPRRCSAKTGSSSSTMRCTCHQNQCLWSSGVSWALAR