secE2 Family assigned · medium auto-curated

H37Rv Rv0379 · MTBC0 - · 71 aa · 455977–456192 (+) · RefSeq YP_177722.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)protein translocase subunit SecE
MTBC0 PGAP re-annotation
Revised (this work)Protein translocase subunit SecE. Pfam: Dodecin (PF07311.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MX43 SwissProt · reviewed · Evidence at protein level
UniProt nameCalcium dodecin
Curated functionBinds calcium ions. May play a role in sequestering additional small ligands.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namesecE2
eggNOG descriptionDodecin
Orthologous groupCOG3360
KEGG orthology K09165
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DodecinPF07311.18 1.2e-203–65 Dodecin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0377 (HTH-type transcriptional regulator), medium confidence from genomic context alone (score 667 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0377 HTH-type transcriptional regulator 667 667 ctx neighborhood:667
Rv0378 hyp hypothetical protein 511 512 ctx neighborhood:510
Rv3091 hyp hypothetical protein 403 404 ctx cooccurence:402
Rv0732 secY preprotein translocase SecY 520 55 textmining:513
Rv1440 secG protein-export membrane protein SecG 718 51 textmining:716
Rv2586c secF protein translocase subunit SecF 719 47 textmining:718
Rv2094c tatA Sec-independent protein translocase membrane-bound protein TatA 414 47 textmining:411
Rv0638 secE1 preprotein translocase SecE 697 46 textmining:696
Rv2587c secD protein translocase subunit SecD 513 46 textmining:511
Rv0559c hyp hypothetical protein 751 41 textmining:751

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): protein translocase subunit SecE
  • Pfam (hmmscan --cut_ga): Dodecin PF07311.18 (E=1e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177722.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Dodecin (PF07311.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3360
  • Curated reference: UniProt Q6MX43 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv0377
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0379|secE2
MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLEVSFKMRPAQPR