PE36 Family assigned · medium auto-curated
H37Rv Rv3893c · MTBC0 - ·
77 aa · 4375762–4375995 (-) ·
RefSeq YP_178025.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE36 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE36. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N660
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein PE36 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | PE36 |
| eggNOG description | PE family |
| Orthologous group | 2AY4M |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.61% of strains (885) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 1.5e-05 | 4–72 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE69 (PPE family protein PPE69), high confidence from genomic context alone (score 787 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3892c PPE69 |
PPE family protein PPE69 | 833 | 787 ctx | neighborhood:787 |
Rv3891c esxD |
ESAT-6 like protein EsxD | 501 | 501 ctx | neighborhood:501 |
Rv3890c esxC |
ESAT-6 like protein EsxC | 493 | 457 ctx | neighborhood:457 |
Rv3894c eccC2 |
ESX-2 type VII secretion system protein EccC | 707 | 427 ctx | neighborhood:427 textmining:511 |
Rv3895c eccB2 |
ESX-2 secretion system protein EccB | 719 | 418 ctx | neighborhood:418 textmining:537 |
Rv3896c hyp |
hypothetical protein | 417 | 417 ctx | neighborhood:417 |
Rv1688 mpg |
3-methyladenine DNA glycosylase | 803 | 41 | textmining:803 |
Rv3539 PPE63 |
PPE family protein PPE63 | 630 | 41 | textmining:630 |
Rv1430 PE16 |
PE family protein PE16 | 626 | 41 | textmining:626 |
Rv0285 PE5 |
PE family protein PE5 | 543 | 41 | textmining:543 |
Rv3872 PE35 |
PE family protein PE35 | 539 | 41 | textmining:540 |
Rv0160c PE4 |
PE family protein PE4 | 517 | 41 | textmining:517 |
Rv1800 PPE28 |
PPE family protein PPE28 | 513 | 41 | textmining:513 |
Rv0152c PE2 |
PE family protein PE2 | 465 | 41 | textmining:466 |
Rv2608 PPE42 |
PPE family protein PPE42 | 415 | 41 | textmining:416 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE36
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=2e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178025.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AY4M - Curated reference: UniProt L7N660 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
PPE69 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3893c|PE36 MVWSVQPEAVLASAAAESAISAETEAAAAGAAPALLSTTPMGGDPDSAMFSAALNACGASYLGVVAEHASQRGLFAG