Rv2386a Still unknown · low auto-curated
H37Rv Rv2386a · MTBC0 - ·
69 aa · 2680458–2680667 (+) ·
RefSeq YP_009030039.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 1y96-assembly2_D crystal structure of the Gemin6/Gemin7 heterodimer fr (prob 0.98, TM 0.69). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2AXCA |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.073 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 76.4 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
1y96-assembly2_D |
0.98 | 0.69 | 3.2e-01 | 1y96-assembly2_D crystal structure of the Gemin6/Gemin7 heterodimer from the human SMN complex |
3ifv-assembly1_A |
0.80 | 0.59 | 5.4e-01 | 3ifv-assembly1_A Crystal structure of the Haloferax volcanii proliferating cell nuclear antigen |
3ifv-assembly1_B |
0.72 | 0.64 | 9.8e-01 | 3ifv-assembly1_B Crystal structure of the Haloferax volcanii proliferating cell nuclear antigen |
3ifv-assembly1_C |
0.63 | 0.62 | 1.2e+00 | 3ifv-assembly1_C Crystal structure of the Haloferax volcanii proliferating cell nuclear antigen |
7jil-assembly1_P |
0.57 | 0.43 | 3.6e-01 | 7jil-assembly1_P 70S ribosome Flavobacterium johnsoniae |
7jsw-assembly1_p |
0.57 | 0.45 | 4.0e-01 | 7jsw-assembly1_p ArfB Rescue of a 70S Ribosome stalled on truncated mRNA with a partial A-site codon (+2-III) |
5h1s-assembly1_R |
0.57 | 0.42 | 4.5e-01 | 5h1s-assembly1_R Structure of the large subunit of the chloro-ribosome |
5jte-assembly1_BP |
0.54 | 0.43 | 3.8e-01 | 5jte-assembly1_BP Cryo-EM structure of an ErmBL-stalled ribosome in complex with A-, P-, and E-tRNA |
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 1y96-assembly2_D crystal structure of the Gemin6/Gemin7 heterodimer from the hum (prob 0.98, E=3e-01, TM=0.69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030039.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AXCA - Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 76.4, confident)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2386a| MFVIRLADGEEVHGECDELTINPATGVLTVCRVDGFEETTTHYSPSAWRSVTHRKRGVGVRPSLVSTAQ