vapC16 Resolved · medium auto-curated

H37Rv Rv2231A · MTBC0 - · 141 aa · 2505736–2506161 (-) · RefSeq YP_007410917.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC16
MTBC0 PGAP re-annotation
Revised (this work)Ribonuclease VapC16.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CV93 SwissProt · reviewed · Inferred from homology
UniProt nameRibonuclease VapC16
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase. The cognate antitoxin is VapB16 (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionribonuclease activity
Orthologous groupCOG3744

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.524 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE8 (PPE family protein PPE8), high confidence from genomic context alone (score 767 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2308 hyp hypothetical protein 791 791 ctx cooccurence:742
Rv0355c PPE8 PPE family protein PPE8 767 767 ctx cooccurence:767
Rv3350c PPE56 PPE family protein PPE56 765 765 ctx cooccurence:765
Rv3347c PPE55 PPE family protein PPE55 765 765 ctx cooccurence:765
Rv1917c PPE34 PPE family protein PPE34 764 764 ctx cooccurence:764
Rv0304c PPE5 PPE family protein PPE5 762 762 ctx cooccurence:762
Rv2209 integral membrane protein 762 762 ctx cooccurence:762
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 761 761 ctx cooccurence:761
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 761 761 ctx cooccurence:761
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 760 760 ctx cooccurence:760
Rv3343c PPE54 PPE family protein PPE54 760 760 ctx cooccurence:760
Rv1004c membrane protein 760 760 ctx cooccurence:760
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 752 752 ctx cooccurence:752
Rv0305c PPE6 PPE family protein PPE6 749 749 ctx cooccurence:749
Rv2082 hyp hypothetical protein 747 747 ctx cooccurence:747

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ribonuclease VapC16
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007410917.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3744
  • Curated reference: UniProt P0CV93 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 94 functional partner(s); context anchor PPE8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2231A|vapC16
MTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHRPGTAAWPDDHHRRRPVSCL