aceAb Resolved · high auto-curated
H37Rv Rv1916 · MTBC0 - ·
398 aa ·
2161566–2162762 H37Rv
(+) ·
RefSeq NP_216432.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | isocitrate lyase AceAb |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Isocitrate lyase AceAb. Pfam: ICL (PF00463.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (5 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Mycobacterium tuberculosis Rv1916 is an Acetyl-CoA-Binding Protein. doi:10.1002/cbic.202300162 | 2023 |
| Lessons Learnt and the Way Forward for Drug Development Against Isocitrate Lyase from Mycobacterium tuberculosis. doi:10.2174/0929866529666221006121831 | 2022 |
| Rv1915 and Rv1916 from Mycobacterium tuberculosis H37Rv form in vitro protein-protein complex. doi:10.1016/j.bbagen.2022.130130 | 2022 |
| Regulation of the icl1 Gene Encoding the Major Isocitrate Lyase in Mycobacterium smegmatis. doi:10.1128/JB.00402-21 | 2021 |
| Structure-function insights into elusive Mycobacterium tuberculosis protein Rv1916. doi:10.1016/j.ijbiomac.2019.09.038 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | aceAb (Rv1915, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.33 (95% CI -0.16 to 3.74). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in glyoxylate bypass, an alternative to the tricarboxylic acid cycle [catalytic activity: isocitrate = succinate + glyoxylate]. |
|---|---|
| Mycobrowser EC |
4.1.3.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1950
· 100.0% identity |
|---|---|
| M. leprae |
ML1985c
· 87.9% identity |
| M. marinum |
MMAR_2821
· 88.4% identity |
| M. smegmatis |
MSMEG_3706
· 78.9% identity |
| M. orygis |
RJtmp_001987
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07717
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative isocitrate lyase subunit B |
| EC (curated) |
EC 4.1.3.1
|
| Curated function | Together with AceAa, they could catalyze the formation of succinate and glyoxylate from isocitrate. |
UniProt still lists this protein as Putative isocitrate lyase subunit B; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | aceAb |
| eggNOG description | Isocitrate lyase |
| Orthologous group | COG2224 |
| EC number |
EC 4.1.3.1
|
| KEGG orthology |
K01637
|
| KEGG pathways |
map00630, map01100, map01110, map01120, map01200
|
| KEGG modules |
M00012
|
| Gene Ontology (6) |
GO:0003674, GO:0003824, GO:0004451, GO:0016829, GO:0016830, GO:0016833
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.313 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.628 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 0.944, mean read count 74.2352941176. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 127.0 ppm · rank 1124/3519 (68.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 398 aa |
|---|---|
| Molecular weight | 44.6 kDa |
| Theoretical pI | 6.21 |
| GRAVY | -0.361 (hydrophilic) |
| Aliphatic index | 82.5 |
| Aromaticity | 0.08 |
| Instability index | 38.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ICL | PF00463.28 | 1.1e-44 | 33–231 | Isocitrate lyase family |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8g8k |
X-ray diffraction | 1.54 Å | 41% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ee1-assembly1_D |
1.00 | 0.89 | 4.1e-62 sig | 6ee1-assembly1_D Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA |
6ee1-assembly1_C |
1.00 | 0.90 | 1.6e-60 sig | 6ee1-assembly1_C Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA |
6edz-assembly1_C |
1.00 | 0.90 | 1.2e-60 sig | 6edz-assembly1_C Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA, form I |
6edz-assembly1_A |
1.00 | 0.90 | 2.0e-60 sig | 6edz-assembly1_A Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA, form I |
6edz-assembly1_B |
1.00 | 0.86 | 1.4e-61 sig | 6edz-assembly1_B Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA, form I |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | aceAa (+ strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | PPE34 (- strand, 169 bp gap) |
| Predicted operon |
aceAa · aceAb
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: aceAa (isocitrate lyase AceAa), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1915 aceAa exp |
isocitrate lyase AceAa | 999 | 1000 ctx | neighborhood:773 fusion:900 cooccurence:774 database:900 |
Rv1837c glcB exp |
malate synthase | 994 | 969 | coexpression:695 database:900 textmining:823 |
Rv0467 icl1 exp |
isocitrate lyase | 931 | 928 | database:900 |
Rv1475c acn exp |
iron-regulated aconitate hydratase | 916 | 908 | database:900 |
Rv2280 exp |
Rv2280, (MTCY339.30c), len: 459 aa. Probable dehydrogenase. Similar to D-lactate dehydrogenase (cytochrome) precursor e.g. G1061264 (587 aa) | 908 | 905 | database:900 |
Rv1257c exp |
oxidoreductase | 903 | 900 | database:900 |
Rv1905c aao exp |
D-amino acid oxidase | 807 | 800 | database:800 |
Rv0409 ackA |
acetate kinase | 667 | 631 | coexpression:631 |
Rv0408 pta |
phosphate acetyltransferase | 689 | 561 | coexpression:561 |
Rv1914c hyp |
hypothetical protein | 554 | 554 ctx | neighborhood:552 |
Rv3667 acs |
acetyl-CoAsynthetase | 470 | 413 | coexpression:411 |
Rv0896 gltA2 |
citrate synthase 1 | 433 | 278 | |
Rv0889c citA |
citrate synthase 2 | 562 | 277 | textmining:420 |
Rv1131 prpC |
methylcitrate synthase PrpC | 435 | 272 | |
Rv1248c kgd |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 580 | 189 | textmining:504 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): isocitrate lyase AceAb
- Pfam (hmmscan --cut_ga): ICL PF00463.28 (E=1e-44)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216432.1)
- Domains: Pfam-A via hmmscan --cut_ga — ICL (PF00463.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2224 - Curated reference: UniProt O07717 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
aceAa - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1916|aceAb MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for aceAb? Email the maintainer — the message is pre-filled with this gene's details.