aceAb Resolved · high auto-curated

H37Rv Rv1916 · MTBC0 - · 398 aa · 2161566–2162762 (+) · RefSeq NP_216432.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)isocitrate lyase AceAb
MTBC0 PGAP re-annotation
Revised (this work)Isocitrate lyase AceAb. Pfam: ICL (PF00463.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07717 SwissProt · reviewed · Evidence at protein level
UniProt namePutative isocitrate lyase subunit B
EC (curated) EC 4.1.3.1
Curated functionTogether with AceAa, they could catalyze the formation of succinate and glyoxylate from isocitrate.

UniProt still lists this protein as Putative isocitrate lyase subunit B; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameaceAb
eggNOG descriptionIsocitrate lyase
Orthologous groupCOG2224
EC number EC 4.1.3.1
KEGG orthology K01637
KEGG pathways map00630, map01100, map01110, map01120, map01200
KEGG modules M00012
Gene Ontology (6) GO:0003674, GO:0003824, GO:0004451, GO:0016829, GO:0016830, GO:0016833

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.313 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ICLPF00463.28 1.1e-4433–231 Isocitrate lyase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aceAa (isocitrate lyase AceAa), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1915 aceAa isocitrate lyase AceAa 999 1000 ctx neighborhood:773 fusion:900 cooccurence:774 database:900
Rv1837c glcB malate synthase 994 969 coexpression:695 database:900 textmining:823
Rv0467 icl1 isocitrate lyase 931 928 database:900
Rv1475c acn iron-regulated aconitate hydratase 916 908 database:900
Rv2280 Rv2280, (MTCY339.30c), len: 459 aa. Probable dehydrogenase. Similar to D-lactate dehydrogenase (cytochrome) precursor e.g. G1061264 (587 aa) 908 905 database:900
Rv1257c oxidoreductase 903 900 database:900
Rv1905c aao D-amino acid oxidase 807 800 database:800
Rv0409 ackA acetate kinase 667 631 coexpression:631
Rv0408 pta phosphate acetyltransferase 689 561 coexpression:561
Rv1914c hyp hypothetical protein 554 554 ctx neighborhood:552
Rv3667 acs acetyl-CoAsynthetase 470 413 coexpression:411
Rv0896 gltA2 citrate synthase 1 433 278
Rv0889c citA citrate synthase 2 562 277 textmining:420
Rv1131 prpC methylcitrate synthase PrpC 435 272
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 580 189 textmining:504

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): isocitrate lyase AceAb
  • Pfam (hmmscan --cut_ga): ICL PF00463.28 (E=1e-44)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216432.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ICL (PF00463.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2224
  • Curated reference: UniProt O07717 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor aceAa
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1916|aceAb
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA