Rv0739 Still unknown · low auto-curated

H37Rv Rv0739 · MTBC0 - · 268 aa · 830855–831661 (+) · RefSeq NP_215253.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4226. Function unknown. Foldseek best (non-significant) hit: 8e4g-assembly1_a Remodeling of the bacteriophage T7 during initial inf (prob 0.99, TM 0.69).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WKS1 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0739

UniProt still lists this protein as Uncharacterized protein Rv0739; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2F1S8

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.21 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 60.18% of strains (87386) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4226PF10774.16 4.8e-275–110 Domain of unknown function (DUF4226)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 80.4 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8e4g-assembly1_a 0.99 0.69 3.0e-01 8e4g-assembly1_a Remodeling of the bacteriophage T7 during initial infection
7ey7-assembly1_A 0.94 0.75 1.1e+00 7ey7-assembly1_A bacteriophage T7 tail complex
6zw4-assembly1_F 0.25 0.50 3.6e+00 6zw4-assembly1_F C14 symmetry: Bacterial Vipp1 and PspA are members of the ancient ESCRT-III membrane-remodeling superfamily.
6nct-assembly1_B 0.23 0.38 1.3e+00 6nct-assembly1_B Structure of p110alpha/niSH2 - vector data collection
6zw6-assembly1_G 0.21 0.50 4.6e+00 6zw6-assembly1_G C16 symmetry: Bacterial Vipp1 and PspA are members of the ancient ESCRT-III membrane-remodeling superfamily.
8qbs-assembly1_A 0.20 0.45 3.6e+00 8qbs-assembly1_A Cryo-EM structure of Vipp1-F197K/L200K helical filament with lattice 1 (Vipp1-F197K/L200K_L1)
8v8i-assembly1_B 0.16 0.38 2.0e+00 8v8i-assembly1_B PI3Ka H1047R co-crystal structure with inhibitor in cryptic pocket (compound 5).
8i7r-assembly1_F4 0.14 0.49 5.8e+00 8i7r-assembly1_F4 In situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0740 hyp hypothetical protein 531 531 ctx neighborhood:524
Rv0738 hyp hypothetical protein 448 448 ctx neighborhood:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF4226 PF10774.16 (E=5e-27)
  • Foldseek best: 8e4g-assembly1_a Remodeling of the bacteriophage T7 during initial infection (prob 0.99, E=3e-01, TM=0.69)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215253.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4226 (PF10774.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2F1S8
  • Curated reference: UniProt P9WKS1 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 80.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0739|
MVLTRRAREVALTQHIGVSAETDRAVVPKLRQAYDSLVCGRRRLGAIGAEIENAVAHQRALGLDTPAGARNFSRFLATKAHDITRVLAATAAESQAGAARLRSLASSYQAVGFGPKPQEPPPDPVPFPPYQPKVWAACRARGQDPDKVVRTFHHAPMSARFRSLPAGDSVLYCGNDKYGLLHIQAKHGRQWHDIADARWPSAGNWRYLADYAIGATLAYPERVEYNQDNDTFAVYRRMSLPDGRYVFTTRVIISARDGKIITAFPQTT