Rv3177 Family assigned · medium auto-curated

H37Rv Rv3177 · MTBC0 mtbc0_003376 · 286 aa · 3570295–3571155 MTBC0 (+) · RefSeq NP_217693.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand moxR3 (Rv3164c) — family_assigned: MoxR family ATPase Rv3165c (Rv3165c) — dark: hypothetical protein Rv3166c (Rv3166c) — family_assigned: DUF4129 domain-containing protein Rv3166c Rv3167c (Rv3167c) — family_assigned: TetR/AcrR family transcriptional regulator Rv3168 (Rv3168) — family_assigned: phosphotransferase family protein Rv3168 Rv3169 (Rv3169) — family_assigned: hypothetical protein Rv3169 aofH (Rv3170) — family_assigned: flavin monoamine oxidase family protein aofH Rv3173c (Rv3173c) — family_assigned: helix-turn-helix domain-containing protein Rv3174 (Rv3174) — family_assigned: SDR family oxidoreductase Rv3175 (Rv3175) — requalified: amidase Rv3175 Rv3177 (Rv3177) — family_assigned: alpha/beta hydrolase Rv3177 Rv3179 (Rv3179) — family_assigned: ATP-binding protein Rv3179 Rv3180c (Rv3180c) — family_assigned: type II toxin-antitoxin system VapC family toxin Rv3181c (Rv3181c) — family_assigned: type II toxin-antitoxin system Phd/YefM family antitoxin Rv3182 (Rv3182) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin Rv3183 (Rv3183) — family_assigned: XRE family transcriptional regulator Rv3188 (Rv3188) — family_assigned: antitoxin Xre/MbcA/ParS toxin-binding domain-containing prot Rv3189 (Rv3189) — family_assigned: RES family NAD+ phosphorylase Rv3190c (Rv3190c) — dark: hypothetical protein Rv3190c Rv3191c (Rv3191c) — family_assigned: IS30 family transposase Rv3191c Rv3193c (Rv3193c) — family_assigned: UPF0182 family protein 3 560 kb 3 564 kb 3 568 kb 3 572 kb 3 576 kb 3 580 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxidase
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.11 (95% CI -0.51 to 3.66). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionSupposedly involved in detoxification reactions.
Mycobrowser EC 1.11.1.-

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3203 · 99.7% identity
M. smegmatis MSMEG_6831 · 39.1% identity
M. orygis RJtmp_003275 · 99.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53327 TrEMBL · unreviewed · Predicted
UniProt namePossible peroxidase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionSerine aminopeptidase, S33
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.11 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.166 (low power) · 6 consensus substitution(s)
low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 3/53 (6%) · mean identity 51.6% · 0/4 closest MTBAP relatives
SENSITIVITY DOWNGRADE: a divergent homolog is detectable at relaxed thresholds (weak hit 68%/96%cov in M_cookii — likely present but divergent); NOT a robust MTBC-specific innovation — present but divergent. The strict tblastn absence was a coverage/identity-threshold artefact.
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 76.875. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
altered fitness under 6 weeks hypoxia (stress) -1.490.042 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Physico-chemical properties (computed, ProtParam)

Length286 aa
Molecular weight30.9 kDa
Theoretical pI8.01
GRAVY-0.2 (hydrophilic)
Aliphatic index86.6
Aromaticity0.073
Instability index21.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 8.9e-2840–272 alpha/beta hydrolase fold
Abhydrolase_6PF12697.14 5.0e-1941–278 Alpha/beta hydrolase family
Hydrolase_4PF12146.16 5.9e-1767–267 Serine aminopeptidase, S33

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.7

PDB hitprobTM-scoreE-valueDescription
4pw0-assembly1_A-2 1.00 0.95 1.6e-31 sig 4pw0-assembly1_A-2 Alpha/beta hydrolase fold protein from Chitinophaga pinensis
6eb3-assembly1_A 1.00 0.80 2.5e-20 sig 6eb3-assembly1_A Structural and enzymatic characterization of an esterase from a metagenomic library
4i3f-assembly1_A 1.00 0.71 1.2e-18 sig 4i3f-assembly1_A Crystal structure of serine hydrolase CCSP0084 from the polyaromatic hydrocarbon (PAH)-degrading bacterium Cycloclasticus zankles
8ynv-assembly4_D 1.00 0.73 1.0e-17 sig 8ynv-assembly4_D Poly(3-hydroxybutyrate) depolymerase PhaZ from Bacillus thuringiensis
8ynw-assembly4_D 1.00 0.75 2.5e-17 sig 8ynw-assembly4_D S102A mutant of poly(3-hydroxybutyrate) depolymerase PhaZ from Bacillus thuringiensis

Foldseek search of the AlphaFold DB model (mean pLDDT 92.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)mesT (- strand, 146 bp gap)
Downstream (3' on genome)Rv3178 (+ strand, 130 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv3178 (nitroreductase), medium confidence from genomic context alone (score 652 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1726 oxidoreductase 767 767 coexpression:767
Rv1528c papA4 polyketide synthase associated protein PapA 732 733 coexpression:732
Rv3175 amidase 654 652 coexpression:651
Rv3178 nitroreductase 651 652 ctx neighborhood:526
Rv3171c hpx non-heme haloperoxidase Hpx 635 635 ctx cooccurence:633
Rv2810c Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for 580 580 coexpression:580
Rv3176c mesT epoxide hydrolase MesT 553 553 ctx neighborhood:540
Rv2940c mas exp multifunctional mycocerosic acid synthase 529 501 experimental:441
Rv3825c pks2 exp phthioceranic/hydroxyphthioceranic acid synthase 529 501 experimental:441
Rv2933 ppsC exp phthiocerol synthesis polyketide synthase type I PpsC 528 501 experimental:441
Rv2048c pks12 exp polyketide synthase 526 498 experimental:441
Rv1527c pks5 exp polyketide synthase 526 498 experimental:441
Rv2946c pks1 polyketide synthase 486 455
Rv0125 pepA serine protease PepA 451 450
Rv1661 pks7 polyketide synthase 456 432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peroxidase
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=9e-28), Abhydrolase_6 PF12697.14 (E=5e-19), Hydrolase_4 PF12146.16 (E=6e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217693.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt O53327 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor Rv3178
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003376|Rv3177|
MPQRQAGDIGATYQDAPTKSINVGGTRFVYRRLGADAGVPVIFLHHLGAVLDNWDPRVVDGIAAKHPVVTFDNRGVGASEGQTPDTVTTMADDAIAFVRALGFDQVDLLGFSLGGFVAQVIAQQEPQLVRKIILAGTGPAGGVGIGKVTFGTIRESIKATLTFRDPKELRFFTRTDSGKSAARQFVKRLKERKDNRDKSITVRAFRSQLKAIHAWGTQKPSDLTSIGHPVLIANGDDDTMVPTSNSLDLADRLPDATLRIYPDAGHGGIFQHHAQFVDDALQFLES