Rv3177 Family assigned · medium auto-curated

H37Rv Rv3177 · MTBC0 mtbc0_003376 · 286 aa · 3570295–3571155 (+) · RefSeq NP_217693.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxidase
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53327 TrEMBL · unreviewed · Predicted
UniProt namePossible peroxidase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionSerine aminopeptidase, S33
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.11 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 8.9e-2840–272 alpha/beta hydrolase fold
Abhydrolase_6PF12697.14 5.0e-1941–278 Alpha/beta hydrolase family
Hydrolase_4PF12146.16 5.9e-1767–267 Serine aminopeptidase, S33

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3178 (nitroreductase), medium confidence from genomic context alone (score 652 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1726 oxidoreductase 767 767 coexpression:767
Rv1528c papA4 polyketide synthase associated protein PapA 732 733 coexpression:732
Rv3175 amidase 654 652 coexpression:651
Rv3178 nitroreductase 651 652 ctx neighborhood:526
Rv3171c hpx non-heme haloperoxidase Hpx 635 635 ctx cooccurence:633
Rv2810c Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for 580 580 coexpression:580
Rv3176c mesT epoxide hydrolase MesT 553 553 ctx neighborhood:540
Rv2940c mas multifunctional mycocerosic acid synthase 529 501 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 529 501 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 528 501 experimental:441
Rv2048c pks12 polyketide synthase 526 498 experimental:441
Rv1527c pks5 polyketide synthase 526 498 experimental:441
Rv2946c pks1 polyketide synthase 486 455
Rv0125 pepA serine protease PepA 451 450
Rv1661 pks7 polyketide synthase 456 432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peroxidase
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=9e-28), Abhydrolase_6 PF12697.14 (E=5e-19), Hydrolase_4 PF12146.16 (E=6e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217693.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt O53327 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor Rv3178
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003376|Rv3177|
MPQRQAGDIGATYQDAPTKSINVGGTRFVYRRLGADAGVPVIFLHHLGAVLDNWDPRVVDGIAAKHPVVTFDNRGVGASEGQTPDTVTTMADDAIAFVRALGFDQVDLLGFSLGGFVAQVIAQQEPQLVRKIILAGTGPAGGVGIGKVTFGTIRESIKATLTFRDPKELRFFTRTDSGKSAARQFVKRLKERKDNRDKSITVRAFRSQLKAIHAWGTQKPSDLTSIGHPVLIANGDDDTMVPTSNSLDLADRLPDATLRIYPDAGHGGIFQHHAQFVDDALQFLES