Rv2292c Family assigned · medium auto-curated

H37Rv Rv2292c · MTBC0 - · 74 aa · 2564029–2564253 (-) · RefSeq NP_216808.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains PNP_UDP_1 (PF01048.27) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLE3 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized protein Rv2292c

UniProt still lists this protein as Uncharacterized protein Rv2292c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
eggNOG descriptionnucleoside metabolic process
Orthologous groupCOG0775
EC number EC 3.2.2.9
KEGG orthology K01243
KEGG pathways map00270, map01100, map01230
KEGG modules M00034, M00609

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PNP_UDP_1PF01048.27 5.2e-074–68 Phosphorylase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gltB (glutamate synthase large subunit), medium confidence from genomic context alone (score 488 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2293c hyp hypothetical protein 869 869 ctx neighborhood:662 fusion:623
Rv3859c gltB glutamate synthase large subunit 487 488 ctx neighborhood:488
Rv2524c fas fatty acid synthase 450 440
Rv0018c pstP phosphoserine/threonine phosphatase PstP 421 421 coexpression:420
Rv2294 cystathionine beta-lyase 437 410
Rv2438c nadE glutamine-dependent NAD(+) synthetase 417 236
Rv0325 hyp hypothetical protein 706 161 textmining:665
Rv1145 mmpL13a transmembrane transport protein 549 45 textmining:548

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): PNP_UDP_1 PF01048.27 (E=5e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216808.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PNP_UDP_1 (PF01048.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0775
  • Curated reference: UniProt P9WLE3 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor gltB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2292c|
MNPGFDAVDQETAAAQAVADAHGVPFLGIRGMSDGPGDPLHLPGFPVQFFVYKQIAANNAARVTEAFLQNWAGV