Rv0965c Family assigned · low

H37Rv Rv0965c · MTBC0 mtbc0_001031 · 139 aa · 1083993–1084412 (-) · RefSeq NP_215480.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)ESX/WXG100-like secreted fold (matches EsxB, PDB 4J7K, TM 0.82); putative ESX-secreted protein.

Curated reference (UniProt)

UniProt P9WKM3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0965c

UniProt still lists this protein as Uncharacterized protein Rv0965c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AYPW

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.338 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 86.8 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4j7k-assembly1_A 1.00 0.82 1.1e-01 4j7k-assembly1_A The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
4j41-assembly2_D 1.00 0.86 1.4e-01 4j41-assembly2_D The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
4j10-assembly1_A 1.00 0.81 1.1e-01 4j10-assembly1_A The crystal structure of a secreted protein ESXB (SeMet-labeled) from Bacillus anthracis str. Sterne
4j41-assembly1_B 1.00 0.87 1.7e-01 4j41-assembly1_B The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
4j7k-assembly2_C 1.00 0.78 1.0e-01 4j7k-assembly2_C The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
4j7k-assembly1_B 1.00 0.89 2.1e-01 4j7k-assembly1_B The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
4j11-assembly1_B 1.00 0.88 2.2e-01 4j11-assembly1_B The crystal structure of a secreted protein ESXB (wild-type, in P21 space group) from Bacillus anthracis str. sterne
4j41-assembly3_E 1.00 0.89 2.0e-01 4j41-assembly3_E The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: csoR (copper-sensing transcriptional repressor CsoR), medium confidence from genomic context alone (score 488 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0966c hyp hypothetical protein 718 718 ctx neighborhood:711
Rv0963c hyp hypothetical protein 592 592 ctx neighborhood:592
Rv0964c hyp hypothetical protein 588 588 ctx neighborhood:587
Rv0967 csoR copper-sensing transcriptional repressor CsoR 488 488 ctx neighborhood:488

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 4j7k-assembly1_A The crystal structure of a secreted protein EsxB (Mutant E54Q) (prob 1.00, E=1e-01, TM=0.82)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215480.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AYPW
  • Curated reference: UniProt P9WKM3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 86.8, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor csoR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001031|Rv0965c|
MRVNRPQCARVPYSAESLVRVEASWYGRTLRAIPEVLSQVGYQQADHGESLLTSHHCCLGAAEGARPGWVGSSAGALSGLLDSWAEASTAHAARIGDHSYGMHLAAVGFAEMEEHNAAALAAVYPTGGGSARCDGVDVS