proC Resolved · high auto-curated

H37Rv Rv0500 · MTBC0 - · 295 aa · 590083–590970 H37Rv (+) · RefSeq NP_215014.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyrroline-5-carboxylate reductase
MTBC0 PGAP re-annotation
Revised (this work)Pyrroline-5-carboxylate reductase. Pfam: F420_oxidored (PF03807.24), NAD_binding_2 (PF03446.22), P5CR_dimer (PF14748.12).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 42 publications

42 TB publications mention this gene. 42 publication(s) discuss this gene (37 in a M. tuberculosis context, 9 in other mycobacteria — M. smegmatis (5), M. leprae (3), M. marinum (2)).

Most recent 5 of 42.
PublicationDate
Manganese Metabolism-Related Gene Signatures as Diagnostic Biomarkers for Tuberculosis: Immune Infiltration Profiling and Molecular Subtype Identification. doi:10.1016/j.micpath.2026.108690 2026
Transcriptional Biomarkers of Differentially Detectable Mycobacterium tuberculosis in Patient Sputum. doi:10.1128/mbio.02701-22 2022
Conserved ESX-1 Substrates EspE and EspF Are Virulence Factors That Regulate Gene Expression. doi:10.1128/IAI.00289-20 2020
EspM Is a Conserved Transcription Factor That Regulates Gene Expression in Response to the ESX-1 System. doi:10.1128/mBio.02807-19 2020
Substrate Interaction with the EssC Coupling Protein of the Type VIIb Secretion System. doi:10.1128/JB.00646-19 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -6.71 (95% CI -8.58 to -4.63). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved at the terminal (third) step in proline biosynthesis [catalytic activity: L-proline + NAD(P)+ = 1-pyrroline-5-carboxylate + NAD(P)H].
Mycobrowser EC 1.5.1.2 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0511 · 99.7% identity
M. leprae ML2430c · 82.4% identity
M. marinum MMAR_0826 · 81.7% identity
M. smegmatis MSMEG_0943 · 72.5% identity
M. orygis RJtmp_000525 · 99.7% identity
M. abscessus MAB_4005c · 64.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WHU7 SwissProt · reviewed · Evidence at protein level
UniProt namePyrroline-5-carboxylate reductase
EC (curated) EC 1.5.1.2
Curated functionCatalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameproC
eggNOG descriptionCatalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline
Orthologous groupCOG0345
EC number EC 1.5.1.2
KEGG orthology K00286
KEGG pathways map00330, map01100, map01110, map01130, map01230
KEGG modules M00015
Gene Ontology (52) GO:0000287, GO:0003674, GO:0003824, GO:0004735, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006560, GO:0006561 +40 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.075 · quasi-invariant (6 sites), pN/pS sous-puissant
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.188 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 80.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 43.9%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 13 in the ORF — 12 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.077, mean read count 20. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
All 13 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainproC-TetOn-2.1 (TetON promoter 2)
Baseline knockdown fitness1.903 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance836.0 ppm · rank 274/3519 (92.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length295 aa
Molecular weight30.2 kDa
Theoretical pI4.73
GRAVY0.392 (hydrophobic)
Aliphatic index104.3
Aromaticity0.044
Instability index31.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
F420_oxidoredPF03807.24 6.6e-197–105 NADP oxidoreductase coenzyme F420-dependent
NAD_binding_2PF03446.22 7.1e-057–85 NAD binding domain of 6-phosphogluconate dehydrogenase
P5CR_dimerPF14748.12 3.1e-34169–290 Pyrroline-5-carboxylate reductase dimerisation

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.1

PDB hitprobTM-scoreE-valueDescription
3tri-assembly1_B 1.00 0.93 1.9e-25 sig 3tri-assembly1_B Structure of a pyrroline-5-carboxylate reductase (proC) from Coxiella burnetii
2rcy-assembly1_A 1.00 0.87 5.7e-24 sig 2rcy-assembly1_A Crystal structure of Plasmodium falciparum pyrroline carboxylate reductase (MAL13P1.284) with NADP bound
5bse-assembly1_A 1.00 0.90 4.0e-22 sig 5bse-assembly1_A Crystal structure of Medicago truncatula (delta)1-Pyrroline-5-Carboxylate Reductase (MtP5CR)
5uau-assembly1_C 1.00 0.87 1.3e-22 sig 5uau-assembly1_C Structure of human PYCR-1 complexed with proline
5uax-assembly1_C 1.00 0.85 6.3e-23 sig 5uax-assembly1_C Structure of apo human PYCR-1 crystallized in space group C2

Foldseek search of the AlphaFold DB model (mean pLDDT 91.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 5

Upstream (5' on genome)Rv0499 (+ strand, 24 bp gap)
Downstream (3' on genome)Rv0500A (+ strand, 140 bp gap)
Predicted operon Rv0496 · Rv0497 · Rv0498 · Rv0499 · proC

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: proB (glutamate 5-kinase protein), high confidence from genomic context alone (score 832 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1188 exp proline dehydrogenase 990 924 database:900 textmining:880
Rv1187 rocA exp pyrroline-5-carboxylate dehydrogenase RocA 957 905 database:900 textmining:570
Rv0840c pip exp proline iminopeptidase 903 903 database:900
Rv0499 hyp hypothetical protein 847 848 ctx neighborhood:846
Rv2439c proB glutamate 5-kinase protein 945 832 ctx cooccurence:660 coexpression:422 textmining:688
Rv0498 hyp hypothetical protein 831 831 ctx neighborhood:830
Rv0496 ppx1 hyp hypothetical protein 816 816 ctx neighborhood:815
Rv0497 transmembrane protein 815 816 ctx neighborhood:815
Rv2427c proA gamma-glutamyl phosphate reductase 936 802 ctx cooccurence:676 textmining:695
Rv0500A DNA-binding protein 744 744 ctx neighborhood:742
Rv0495c hyp hypothetical protein 737 737 ctx neighborhood:737
Rv0500B Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ 465 464 ctx neighborhood:461
Rv2146c transmembrane protein 436 436
Rv2148c hyp hypothetical protein 478 424
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 414 340

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): pyrroline-5-carboxylate reductase
  • Pfam (hmmscan --cut_ga): F420_oxidored PF03807.24 (E=7e-19), NAD_binding_2 PF03446.22 (E=7e-05), P5CR_dimer PF14748.12 (E=3e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215014.1)
  • Domains: Pfam-A via hmmscan --cut_ga — F420_oxidored (PF03807.24), NAD_binding_2 (PF03446.22), P5CR_dimer (PF14748.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0345
  • Curated reference: UniProt P9WHU7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor proB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0500|proC
MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE