proC Resolved · high auto-curated

H37Rv Rv0500 · MTBC0 - · 295 aa · 590083–590970 (+) · RefSeq NP_215014.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyrroline-5-carboxylate reductase
MTBC0 PGAP re-annotation
Revised (this work)Pyrroline-5-carboxylate reductase. Pfam: F420_oxidored (PF03807.24), NAD_binding_2 (PF03446.22), P5CR_dimer (PF14748.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHU7 SwissProt · reviewed · Evidence at protein level
UniProt namePyrroline-5-carboxylate reductase
EC (curated) EC 1.5.1.2
Curated functionCatalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameproC
eggNOG descriptionCatalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline
Orthologous groupCOG0345
EC number EC 1.5.1.2
KEGG orthology K00286
KEGG pathways map00330, map01100, map01110, map01130, map01230
KEGG modules M00015
Gene Ontology (52) GO:0000287, GO:0003674, GO:0003824, GO:0004735, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006560, GO:0006561 +40 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.075 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
F420_oxidoredPF03807.24 6.6e-197–105 NADP oxidoreductase coenzyme F420-dependent
NAD_binding_2PF03446.22 7.1e-057–85 NAD binding domain of 6-phosphogluconate dehydrogenase
P5CR_dimerPF14748.12 3.1e-34169–290 Pyrroline-5-carboxylate reductase dimerisation

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: proB (glutamate 5-kinase protein), high confidence from genomic context alone (score 832 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1188 proline dehydrogenase 990 924 database:900 textmining:880
Rv1187 rocA pyrroline-5-carboxylate dehydrogenase RocA 957 905 database:900 textmining:570
Rv0840c pip proline iminopeptidase 903 903 database:900
Rv0499 hyp hypothetical protein 847 848 ctx neighborhood:846
Rv2439c proB glutamate 5-kinase protein 945 832 ctx cooccurence:660 coexpression:422 textmining:688
Rv0498 hyp hypothetical protein 831 831 ctx neighborhood:830
Rv0496 ppx1 hyp hypothetical protein 816 816 ctx neighborhood:815
Rv0497 transmembrane protein 815 816 ctx neighborhood:815
Rv2427c proA gamma-glutamyl phosphate reductase 936 802 ctx cooccurence:676 textmining:695
Rv0500A DNA-binding protein 744 744 ctx neighborhood:742
Rv0495c hyp hypothetical protein 737 737 ctx neighborhood:737
Rv0500B Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ 465 464 ctx neighborhood:461
Rv2146c transmembrane protein 436 436
Rv2148c hyp hypothetical protein 478 424
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 414 340

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): pyrroline-5-carboxylate reductase
  • Pfam (hmmscan --cut_ga): F420_oxidored PF03807.24 (E=7e-19), NAD_binding_2 PF03446.22 (E=7e-05), P5CR_dimer PF14748.12 (E=3e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215014.1)
  • Domains: Pfam-A via hmmscan --cut_ga — F420_oxidored (PF03807.24), NAD_binding_2 (PF03446.22), P5CR_dimer (PF14748.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0345
  • Curated reference: UniProt P9WHU7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor proB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0500|proC
MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE