Rv0488 Resolved · high auto-curated
H37Rv Rv0488 · MTBC0 - ·
201 aa · 577664–578269 (+) ·
RefSeq NP_215002.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | amino acid transporter |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Amino acid transporter. Pfam: LysE (PF01810.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WK33
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Putative amino-acid transporter Rv0488 |
UniProt still lists this protein as Putative amino-acid transporter Rv0488; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | lysE |
| eggNOG description | Lysine exporter protein LysE YggA |
| Orthologous group | COG1279 |
| KEGG orthology |
K06895
|
| Gene Ontology (49) |
GO:0003333, GO:0003674, GO:0005215, GO:0005342, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0006811, GO:0006812, GO:0006820, GO:0006865 +37 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.369 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LysE | PF01810.25 | 4.2e-49 | 3–187 | LysE type translocator |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: lysG (HTH-type transcriptional regulator), high confidence from genomic context alone (score 800 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1985c lysG |
HTH-type transcriptional regulator | 858 | 800 ctx | cooccurence:774 |
Rv0489 gpm1 |
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase | 507 | 507 ctx | neighborhood:502 |
Rv0486 mshA |
D-inositol 3-phosphate glycosyltransferase | 521 | 419 ctx | neighborhood:419 |
Rv0487 hyp |
hypothetical protein | 419 | 419 ctx | neighborhood:419 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): amino acid transporter
- Pfam (hmmscan --cut_ga): LysE PF01810.25 (E=4e-49)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215002.1)
- Domains: Pfam-A via hmmscan --cut_ga — LysE (PF01810.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1279 - Curated reference: UniProt P9WK33 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
4 functional partner(s); context anchor
lysG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0488| MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII