Rv1706A Still unknown · low auto-curated

H37Rv Rv1706A · MTBC0 - · 55 aa · 1934482–1934649 (-) · RefSeq YP_177651.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3q1p-assembly1_B Crystal structure of CDP-Chase (prob 0.41, TM 0.85).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FL4 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 72.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3q1p-assembly1_B 0.41 0.85 5.3e+00 3q1p-assembly1_B Crystal structure of CDP-Chase
5jbr-assembly1_B 0.35 0.78 4.7e+00 5jbr-assembly1_B Crystal structure of uncharacterized protein Bcav_2135 from Beutenbergia cavernae
6nci-assembly1_B 0.33 0.86 6.6e+00 6nci-assembly1_B Crystal structure of CDP-Chase: Vector data collection
1ezj-assembly1_A 0.28 0.75 6.1e+00 1ezj-assembly1_A CRYSTAL STRUCTURE OF THE MULTIMERIZATION DOMAIN OF THE PHOSPHOPROTEIN FROM SENDAI VIRUS
5n5f-assembly1_B 0.18 0.74 9.9e+00 5n5f-assembly1_B Crystal structure of Haliangium ochraceum encapsulated ferritin
6sv1-assembly1_F 0.14 0.52 5.7e+00 6sv1-assembly1_F Crystal structure of Rhodospirillum rubrum Rru_A0973 E34A variant
7s5c-assembly1_J 0.13 0.66 9.9e+00 7s5c-assembly1_J M. xanthus ferritin-like protein EncB
6suw-assembly3_V 0.11 0.52 8.1e+00 6suw-assembly3_V Crystal structure of Rhodospirillum rubrum Rru_A0973 E31A variant

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1707 (transmembrane protein), medium confidence from genomic context alone (score 503 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1707 transmembrane protein 503 503 ctx neighborhood:498
Rv1710 scpB segregation and condensation protein ScpB 460 459 ctx neighborhood:459
Rv1708 initiation inhibitor protein 460 459 ctx neighborhood:459
Rv1713 engA GTPase Der 453 453 ctx neighborhood:452
Rv1712 cmk cytidylate kinase 453 453 ctx neighborhood:452
Rv1709 scpA segregation and condensation protein ScpA 452 452 ctx neighborhood:452
Rv1711 RNA pseudouridine synthase 452 452 ctx neighborhood:452
Rv1706c PPE23 PPE family protein PPE23 871 50 textmining:870
Rv3047c hyp hypothetical protein 804 47 textmining:803
Rv0190 ricR hyp hypothetical protein 436 47 textmining:433
Rv2325c hyp hypothetical protein 803 45 textmining:803
Rv1382 hyp hypothetical protein 658 43 textmining:658
Rv2898c hyp hypothetical protein 803 41 textmining:803
Rv3102c ftsE cell division ATP-binding protein FtsE 517 41 textmining:517
Rv2736c recX regulatory protein RecX 432 41 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 3q1p-assembly1_B Crystal structure of CDP-Chase (prob 0.41, E=5e+00, TM=0.85)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177651.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt Q79FL4 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 72.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv1707
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1706A|
MGSLAAFKLGWLLSAMAPNVVLLTAFRVPQGLTMLTVFATGQAGQHRCRTFHVTP