bpoA Resolved · high auto-curated

H37Rv Rv3473c · MTBC0 - · 261 aa · 3889948–3890733 (-) · RefSeq NP_217990.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peroxidase BpoA
MTBC0 PGAP re-annotation
Revised (this work)Peroxidase BpoA. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06338 TrEMBL · unreviewed · Predicted
UniProt namePossible peroxidase BpoA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namebpoA
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.171 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.80% of strains (1168) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 2.8e-181–238 alpha/beta hydrolase fold
Abhydrolase_6PF12697.14 6.0e-191–248 Alpha/beta hydrolase family
Hydrolase_4PF12146.16 4.9e-122–242 Serine aminopeptidase, S33

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3474 (Possible transposase for insertion element IS6110 (fragment); Rv3474, (MTCY13E12.27), len: 108 aa. Probable transposase subunit for IS6110. ), medium confidence from genomic context alone (score 552 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3474 Possible transposase for insertion element IS6110 (fragment); Rv3474, (MTCY13E12.27), len: 108 aa. Probable transposase subunit for IS6110. 552 552 ctx neighborhood:546
Rv3475 Possible transposase for insertion element IS6110 [second part]; Rv3475, (MTCY13E12.28), len: 328 aa. Probable transposase subunit for IS611 549 549 ctx neighborhood:546
Rv2627c hyp hypothetical protein 555 539
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 532 504 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 529 501 experimental:441
Rv2048c pks12 polyketide synthase 529 501 experimental:441
Rv1527c pks5 polyketide synthase 528 501 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 527 500 experimental:441
Rv2946c pks1 polyketide synthase 488 458
Rv1661 pks7 polyketide synthase 454 430
Rv1181 pks4 polyketide beta-ketoacyl synthase 451 426
Rv0216 hydratase 418 418 ctx cooccurence:408
Rv1663 pks17 polyketide synthase 436 416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): peroxidase BpoA
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=3e-18), Abhydrolase_6 PF12697.14 (E=6e-19), Hydrolase_4 PF12146.16 (E=5e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217990.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt O06338 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv3474
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3473c|bpoA
MVFLHGGGQTRRSWGRAAAAVAERGWQAVTIDLRGHGESDWSSEGDYRLVSFAGDIQEVLRNLPGQPALVGASLGGFAAMLLAGELSPGIASAVVLVDIVPNMDLAGASRIHAFMAERVESGFGSLDEVADVIANYNPHRPRPSDPDGLVANLRRRGDRWYWHWDPQFIGGIAAFPPVEVTDVDRMNAAVATILRDEVPVLLVRGQVSDIVRQESADQFLSRFPQVEFTDVRGAGHMVAGDRNDAFAGAVLDFLARHVGVR