bpoA Resolved · high auto-curated
H37Rv Rv3473c · MTBC0 - ·
261 aa ·
3889948–3890733 H37Rv
(-) ·
RefSeq NP_217990.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | peroxidase BpoA |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Peroxidase BpoA. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
PyrR (pyrR), Lsr2 (lsr2).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.47 (95% CI -0.87 to 1.99). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Supposedly involved in detoxification reactions. |
|---|---|
| Mycobrowser EC |
1.11.1.-
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3502c
· 99.6% identity |
|---|---|
| M. marinum |
MMAR_4960
· 81.0% identity |
| M. orygis |
RJtmp_003580
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O06338
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible peroxidase BpoA |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | bpoA |
| eggNOG description | Alpha beta hydrolase |
| Orthologous group | COG2267 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.171 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.80% of strains (1168) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.172 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 75.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 43.2% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 181.666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1.65 ppm · rank 3198/3519 (9.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 261 aa |
|---|---|
| Molecular weight | 28.2 kDa |
| Theoretical pI | 5.22 |
| GRAVY | -0.03 (hydrophilic) |
| Aliphatic index | 91.2 |
| Aromaticity | 0.08 |
| Instability index | 36.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 2.8e-18 | 1–238 | alpha/beta hydrolase fold |
Abhydrolase_6 | PF12697.14 | 6.0e-19 | 1–248 | Alpha/beta hydrolase family |
Hydrolase_4 | PF12146.16 | 4.9e-12 | 2–242 | Serine aminopeptidase, S33 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3kxp-assembly4_G |
1.00 | 0.75 | 8.6e-14 sig | 3kxp-assembly4_G Crystal Structure of E-2-(Acetamidomethylene)succinate Hydrolase |
4d9j-assembly1_A |
1.00 | 0.65 | 2.3e-11 sig | 4d9j-assembly1_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains |
4iq4-assembly1_A |
1.00 | 0.70 | 3.3e-10 sig | 4iq4-assembly1_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form |
4ns4-assembly1_A |
1.00 | 0.68 | 2.8e-10 sig | 4ns4-assembly1_A Crystal structure of cold-active estarase from Psychrobacter cryohalolentis K5T |
3ia2-assembly1_C |
1.00 | 0.65 | 1.3e-10 sig | 3ia2-assembly1_C Pseudomonas fluorescens esterase complexed to the R-enantiomer of a sulfonate transition state analog |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3472 (+ strand, 79 bp gap) |
|---|---|
| Downstream (3' on genome) | kgtP (- strand, 1637 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv3474 (Possible transposase for insertion element IS6110 (fragment); Rv3474, (MTCY13E12.27), len: 108 aa. Probable transposase subunit for IS6110. ), medium confidence from genomic context alone (score 552 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3474 |
Possible transposase for insertion element IS6110 (fragment); Rv3474, (MTCY13E12.27), len: 108 aa. Probable transposase subunit for IS6110. | 552 | 552 ctx | neighborhood:546 |
Rv3475 |
Possible transposase for insertion element IS6110 [second part]; Rv3475, (MTCY13E12.28), len: 328 aa. Probable transposase subunit for IS611 | 549 | 549 ctx | neighborhood:546 |
Rv2627c hyp |
hypothetical protein | 555 | 539 | |
Rv2933 ppsC exp |
phthiocerol synthesis polyketide synthase type I PpsC | 532 | 504 | experimental:441 |
Rv2940c mas exp |
multifunctional mycocerosic acid synthase | 529 | 501 | experimental:441 |
Rv2048c pks12 exp |
polyketide synthase | 529 | 501 | experimental:441 |
Rv1527c pks5 exp |
polyketide synthase | 528 | 501 | experimental:441 |
Rv3825c pks2 exp |
phthioceranic/hydroxyphthioceranic acid synthase | 527 | 500 | experimental:441 |
Rv2946c pks1 |
polyketide synthase | 488 | 458 | |
Rv1661 pks7 |
polyketide synthase | 454 | 430 | |
Rv1181 pks4 |
polyketide beta-ketoacyl synthase | 451 | 426 | |
Rv0216 |
hydratase | 418 | 418 ctx | cooccurence:408 |
Rv1663 pks17 |
polyketide synthase | 436 | 416 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): peroxidase BpoA
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=3e-18), Abhydrolase_6 PF12697.14 (E=6e-19), Hydrolase_4 PF12146.16 (E=5e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217990.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2267 - Curated reference: UniProt O06338 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
Rv3474 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3473c|bpoA MVFLHGGGQTRRSWGRAAAAVAERGWQAVTIDLRGHGESDWSSEGDYRLVSFAGDIQEVLRNLPGQPALVGASLGGFAAMLLAGELSPGIASAVVLVDIVPNMDLAGASRIHAFMAERVESGFGSLDEVADVIANYNPHRPRPSDPDGLVANLRRRGDRWYWHWDPQFIGGIAAFPPVEVTDVDRMNAAVATILRDEVPVLLVRGQVSDIVRQESADQFLSRFPQVEFTDVRGAGHMVAGDRNDAFAGAVLDFLARHVGVR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for bpoA? Email the maintainer — the message is pre-filled with this gene's details.