PE_PGRS47 Family assigned · medium auto-curated

H37Rv Rv2741 · MTBC0 - · 525 aa · 3053914–3055491 (+) · RefSeq YP_177902.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE-PGRS family protein PE_PGRS47
MTBC0 PGAP re-annotation
Revised (this work)PE-PGRS family protein PE_PGRS47. Pfam: PE (PF00934.26), PGRS (PF21526.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FB3 SwissProt · reviewed · Inferred from homology
UniProt namePE-PGRS family protein PE_PGRS47
Curated functionContributes to evasion of both innate and adaptive immunity. Inhibits autophagy in infected host phagocytes and inhibits major histocompatibility complex (MHC) class II antigen presentation by mycobacteria-infected dendritic cells. Has an important role in the growth and survival of M.tuberculosis, particularly during intracellular growth and in the later chronic phase of infection.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPE-PGRS family
Orthologous groupCOG3391

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.317 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 11.57% of strains (16802) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 1.5e-324–94 PE family
PGRSPF21526.3 1.5e-07118–189 PGRS repeats

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ephG (epoxide hydrolase), medium confidence from genomic context alone (score 461 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2740 ephG epoxide hydrolase 461 461 ctx neighborhood:461
Rv2352c PPE38 PPE family protein PPE38 625 41 textmining:625
Rv0388c PPE9 Rv0388c, (MTV036.23c), len: 180 aa. PPE9, Member of the Mycobacterium tuberculosis PPE family, highly similar to others e.g. MTCY10G2_10|Z92 485 41 textmining:485
Rv0878c PPE13 PPE family protein PPE13 438 41 textmining:438
Rv3892c PPE69 PPE family protein PPE69 431 41 textmining:431
Rv2544 lppB lipoprotein LppB 403 41 textmining:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS47
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=2e-32), PGRS PF21526.3 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177902.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3391
  • Curated reference: UniProt Q79FB3 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor ephG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2741|PE_PGRS47
MSFVIAAPEFLTAAAMDLASIGSTVSAASAAASAPTVAILAAGADEVSIAVAALFGMHGQAYQALSVQASAFHQQFVQALTAGAYSYASAEAAAVTPLQQLVDVINAPFRSALGRPLIGNGANGKPGTGQDGGAGGLLYGSGGNGGSGLAGSGQKGGNGGAAGLFGNGGAGGAGASNQAGNGGAGGNGGAGGLIWGTAGTGGNGGFTTFLDAAGGAGGAGGAGGLFGAGGAGGVGGAALGGGAQAAGGNGGAGGVGGLFGAGGAGGAGGFSDTGGTGGAGGAGGLFGPGGGSGGVGGFGDTGGTGGDGGSGGLFGVGGAGGHGGFGSAAGGDGGAGGAGGTVFGSGGAGGAGGVATVAGHGGHGGNAGLLYGTGGAGGAGGFGGFGGDGGDGGIGGLVGSGGAGGSGGTGTLSGGRGGAGGNAGTFYGSGGAGGAGGESDNGDGGNGGVGGKAGLVGEGGNGGDGGATIAGKGGSGGNGGNAWLTGQGGNGGNAAFGKAGTGSVGVGGAGGLLEGQNGENGLLPS