vapB9 Resolved · medium auto-curated

H37Rv Rv0959A · MTBC0 - · 73 aa · 1073327–1073548 (+) · RefSeq YP_007409620.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB9
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB9.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJ55 SwissProt · reviewed · Predicted
UniProt namePutative antitoxin VapB9
Curated functionAntitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC9.

UniProt still lists this protein as Putative antitoxin VapB9; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2E5R2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC9 (ribonuclease VapC9), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0960 vapC9 ribonuclease VapC9 882 882 ctx neighborhood:882
Rv0959 hyp hypothetical protein 653 653 ctx neighborhood:653
Rv0958 magnesium chelatase 627 627 ctx neighborhood:627
Rv0961 integral membrane protein 496 496 ctx neighborhood:496
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 440 440 ctx neighborhood:440
Rv0956 purN phosphoribosylglycinamide formyltransferase PurN 440 440 ctx neighborhood:440
Rv2601A vapB41 antitoxin VapB41 806 41 textmining:806
Rv1952 vapB14 antitoxin VapB14 653 41 textmining:653
Rv0662c vapB7 antitoxin VapB7 624 41 textmining:624
Rv0277A vapB25 Rv0277A, len: 85 aa. Possible vapB25, antitoxin,part of toxin-antitoxin (TA) operon with Rv0277c, see Arcus et al. 2005. Has in-frame stop c 570 41 textmining:570
Rv2871 vapB43 antitoxin VapB43 512 41 textmining:512
Rv2830c vapB22 antitoxin VapB22 511 41 textmining:511
Rv1721c vapB12 antitoxin VapB12 511 41 textmining:511
Rv3167c TetR family transcriptional regulator 510 41 textmining:510
Rv1960c parD1 antitoxin ParD1 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB9
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007409620.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5R2
  • Curated reference: UniProt P9WJ55 (SwissProt, reviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor vapC9
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0959A|vapB9
MKTLYLRNVPDDVVERLERLAELAKTSVSAVAVRELTEASRRADNPALLGDLPDIGIDTTELIGGIDAERAGR