Rv1159A Resolved · high auto-curated
H37Rv Rv1159A · MTBC0 - ·
94 aa ·
1286284–1286568 H37Rv
(-) ·
RefSeq YP_177641.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 4a-hydroxytetrahydrobiopterin dehydratase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 4a-hydroxytetrahydrobiopterin dehydratase. Pfam: Pterin_4a (PF01329.25). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 1 % of gene
| Neighbour | pimE (Rv1159, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
1 reported modified residue(s):
N-acetylalanine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 0.80 (95% CI -0.43 to 2.56). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser EC |
4.2.1.96
· agrees with the atlas
|
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1191c
· 100.0% identity |
|---|---|
| M. leprae |
ML1503A
· 71.0% identity |
| M. marinum |
MMAR_4291
· 76.3% identity |
| M. smegmatis |
MSMEG_5150
· 75.3% identity |
| M. orygis |
RJtmp_001222
· 100.0% identity |
| M. abscessus |
MAB_1307c
· 62.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WI93
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative pterin-4-alpha-carbinolamine dehydratase |
| EC (curated) |
EC 4.2.1.96
|
UniProt still lists this protein as Putative pterin-4-alpha-carbinolamine dehydratase; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | phhB |
| eggNOG description | dehydratase |
| Orthologous group | COG2154 |
| EC number |
EC 4.2.1.96
|
| KEGG orthology |
K01724
|
| KEGG pathways |
map00790
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 76.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 48.2% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 53.6666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1028.0 ppm · rank 223/3519 (93.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 94 aa |
|---|---|
| Molecular weight | 10.4 kDa |
| Theoretical pI | 5.36 |
| GRAVY | -0.031 (hydrophilic) |
| Aliphatic index | 92.4 |
| Aromaticity | 0.064 |
| Instability index | 42.7 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pterin_4a | PF01329.25 | 7.5e-30 | 4–90 | Pterin 4 alpha carbinolamine dehydratase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3jst-assembly2_B |
1.00 | 0.93 | 5.4e-09 sig | 3jst-assembly2_B Crystal structure of transcriptional coactivator/pterin dehydratase from Brucella Melitensis |
2ebb-assembly1_A-2 |
1.00 | 0.95 | 2.4e-08 sig | 2ebb-assembly1_A-2 Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from Geobacillus kaustophilus HTA426 |
3hxa-assembly1_D |
1.00 | 0.89 | 1.3e-07 sig | 3hxa-assembly1_D Crystal Structure of DCoH1Thr51Ser |
1ru0-assembly1_A |
1.00 | 0.87 | 1.3e-07 sig | 1ru0-assembly1_A Crystal structure of DCoH2, a paralog of DCoH, the Dimerization Cofactor of HNF-1 |
4wil-assembly1_A |
1.00 | 0.87 | 1.8e-07 sig | 4wil-assembly1_A Crystal structure of DCoH2 S51T |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) active site conserved
| M-CSA entry | 73 · EC 4.2.1.96 |
|---|---|
| Catalytic residues | 5/6 identical (6/6 aligned) |
| Verdict | ACTIVE-SITE CONSERVED (5/6 catalytic residues identical) -> likely active enzyme |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | pimE (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | mutT2 (+ strand, 26 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mutT2 (8-oxo-dGTP diphosphatase), medium confidence from genomic context alone (score 669 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3110 moaB1 exp |
pterin-4-alpha-carbinolamine dehydratase | 918 | 918 | database:900 |
Rv1160 mutT2 |
8-oxo-dGTP diphosphatase | 669 | 669 ctx | neighborhood:622 |
Rv1161 narG |
nitrate reductase subunit alpha | 440 | 441 ctx | neighborhood:437 |
Rv1163 narJ |
nitrate reductase subunit delta | 434 | 435 ctx | neighborhood:431 |
Rv0976c hyp |
hypothetical protein | 480 | 430 | coexpression:410 |
Rv1159 pimE |
polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase | 871 | 49 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 4a-hydroxytetrahydrobiopterin dehydratase
- Pfam (hmmscan --cut_ga): Pterin_4a PF01329.25 (E=8e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177641.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pterin_4a (PF01329.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2154 - Curated reference: UniProt P9WI93 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.8)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 73; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
6 functional partner(s); context anchor
mutT2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1159A| MAVLTDEQVDAALHDLNGWQRAGGVLRRSIKFPTFMAGIDAVRRVAERAEEVNHHPDIDIRWRTVTFALVTHAVGGITENDIAMAHDIDAMFGA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1159A? Email the maintainer — the message is pre-filled with this gene's details.