Rv3178a Resolved · medium
H37Rv Rv3178a · MTBC0 - ·
97 aa ·
3547037–3547330 H37Rv
(+) ·
RefSeq YP_009030043.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Minimal nucleotidyltransferase of the polymerase-beta-like superfamily (HHpred COG1669 95.7%, E=0.16, with strongly converging hits to putative/minimal nucleotidyltransferases and to MntA-type nucleotidyltransferase antitoxins). Confident fold assignment. Genomic context does NOT support a toxin-antitoxin antitoxin role (Rv3178a is a singleton flanked by a nitroreductase and an AAA ATPase at 239/287 bp, no adjacent toxin), so most likely a standalone nucleotidyltransferase; the precise substrate/acceptor remains undefined. |
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 55% of residues (metapredict) |
|---|---|
| Disordered regions | 1 IDR(s), longest 45 aa [52-97] |
carries a substantial disordered region (45/97 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.739 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) MTBC-specific
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives SENSITIVITY DOWNGRADE: a divergent homolog is detectable at relaxed thresholds (weak hit 69%/30%cov in M_bouchedurhonense — likely present but divergent); NOT a robust MTBC-specific innovation — present but divergent. The strict tblastn absence was a coverage/identity-threshold artefact. |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria short ORF (97 aa) a shallow stratum may reflect homology-detection failure, not true youth absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox) signal peptide
| Prediction | predicted secreted protein (signal peptide) |
|---|---|
| DeepTMHMM class | SP |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 97 aa |
|---|---|
| Molecular weight | 10.6 kDa |
| Theoretical pI | 5.13 |
| GRAVY | -0.547 (hydrophilic) |
| Aliphatic index | 90.5 |
| Aromaticity | 0.01 |
| Instability index | 50.4 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
HHpred profile-profile:
top hits COG1669 predicted nucleotidyltransferase (95.7%, E=0.16), SCOP/1WOT minimal nucleotidyltransferase (88-92%), 6M6U MntA antitoxin NTase fold (86%, E=15).
Remote homology search on the deep UniRef30 profile (MPI Toolkit), run for the residual dark set.
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 47.6 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
4jo7-assembly1_C |
0.06 | 0.41 | 7.8e+00 | 4jo7-assembly1_C Crystal structure of the human Nup49CCS2+3* Nup57CCS3* complex with 2:2 stoichiometry |
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3178 (+ strand, 239 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3179 (+ strand, 287 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 4jo7-assembly1_C Crystal structure of the human Nup49CCS2+3* Nup57CCS3* complex (prob 0.06, E=8e+00, TM=0.41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030043.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 47.6, very low)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: Zimmermann L, Stephens A, Nam SZ, et al. (2018). A Completely Reimplemented MPI Bioinformatics Toolkit with a New HHpred Server at its Core Journal of Molecular Biology. doi:10.1016/j.jmb.2017.12.007
Ancestral MTBC0 protein sequence
>H37Rv|Rv3178a| MTAAEDKEERLRLSGTRIELEELLQLPVDVAYEGLLTDDVSESVRKKLITLRAGPSRTACSNLRNPAGVGADDGARRDVVHQRDIADGTGVEPATHR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3178a? Email the maintainer — the message is pre-filled with this gene's details.