gORF_44524 microprotein
A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown. It lies on the same strand within mbtM, i.e. an alternative reading frame of a known gene (dual coding) rather than a new locus.
Evidence & coordinates
| Detection method | MS peptide-spectrum (compendium) |
|---|---|
| Existence evidence | high-confidence peptide-spectrum match (Spectrum Forest hc) (tier T1) |
| Cross-validation | no Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5) |
| H37Rv coordinates | 1509874–1510128 (+ strand) |
| Length | 87 amino acids |
| Start codon | ATG |
| Shine-Dalgarno | SD absent |
| Folding free energy | -1.423445 |
| Predicted localisation | Cytoplasmic (2.52) |
| Conservation | homologues detected in Mycobacteria |
| Overlaps locus | mbtM (Rv1345) — by genomic geometry |
Sequence
MLMVTAVPRHGARFRALCCAGRCAALVGPDDGVHGVAVPLVELALGQWCHHDRGTELRLQPHRQIRQAGIRGRPGCPASDAQRWRAG
Source: de Souza EV et al., Sci Rep 2024;14:31186 (doi:10.1038/s41598-024-82465-w); proteogenomics microprotein compendium. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins