gORF_42930 microprotein

Same-strand overlap (alternative frame) existence proven (MS) function unknown essential 69 aa

A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown. It lies on the same strand within rfe, i.e. an alternative reading frame of a known gene (dual coding) rather than a new locus.

Evidence & coordinates

Detection methodMS peptide-spectrum (compendium)
Existence evidencehigh-confidence peptide-spectrum match (Spectrum Forest hc) (tier T2)
Cross-validationno Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5)
H37Rv coordinates1458261–1458386 (+ strand)
Length69 amino acids
Start codonTTG
Shine-DalgarnoSD absent
Folding free energy0.0
Predicted localisationCytoplasmic (1.988)
Essentiality (TnSeq)essential
Conservationhomologues detected in Mycobacteria
Overlaps locusrfe (Rv1302) — by genomic geometry

Sequence

MVWTRPACSASRRTCTHCEDSANCSQLLHVRRVFSSQVGAVRSRGVQRCGRRCRWLARPVLSRRRCPAA

Source: de Souza EV et al., Sci Rep 2024;14:31186 (doi:10.1038/s41598-024-82465-w); proteogenomics microprotein compendium. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins