Smith_31824_m microprotein
Intergenic (novel locus)
existence proven (MS)
function unknown
47 aa
A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown. It maps to an intergenic region (a genuinely novel locus, no overlapping CDS).
Evidence & coordinates
| Detection method | Ribo-seq / Ribo-RET translation (Smith 2022) |
|---|---|
| Existence evidence | Ribo-seq / Ribo-RET translation (relative ribosome density 0.83); MS-detected (1 peptide(s)); protein-coding G/C-skew signature (p=0.0181987) |
| Cysteines | (the VapC4 method targets Cys codons) |
| Cross-validation | no Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5) |
| H37Rv coordinates | 31824–31967 (- strand) |
| Length | 47 amino acids |
Sequence
MADSALQQQLDEVRALLTRARELFGPNPIEPPTDIAPDPDSTKTWLI
Source: Smith C, Canestrari JG, Wang AJ et al., eLife 2022;11:e73980 (doi:10.7554/eLife.73980; PMC9094748); ribosome-profiling translatome. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins