Smith_3110507_m microprotein

Same-strand overlap (alternative frame) existence proven (MS) function unknown 76 aa

A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown.

Evidence & coordinates

Detection methodRibo-seq / Ribo-RET translation (Smith 2022)
Existence evidenceRibo-seq / Ribo-RET translation (relative ribosome density 1.54); MS-detected (1 peptide(s)); protein-coding G/C-skew signature (p=0.00172006)
Cysteines (the VapC4 method targets Cys codons)
Cross-validationno Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5)
H37Rv coordinates3110507–3110737 (- strand)
Length76 amino acids

Sequence

VKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANAWQEWSAAGDTDAWEQTVGDGVGDAPR

Source: Smith C, Canestrari JG, Wang AJ et al., eLife 2022;11:e73980 (doi:10.7554/eLife.73980; PMC9094748); ribosome-profiling translatome. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins