ORF_84 microprotein
Antisense to a gene
existence proven (MS)
function unknown
62 aa
A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown.
Evidence & coordinates
| Detection method | VapC4 ribosome-stalling (5'-OH RNA-seq) |
|---|---|
| Existence evidence | VapC4 ribosome-stalling (5'-OH RNA-seq); MS-validated (ProteomeXchange PXD011466, PXD013677); cross-validated by Ribo-RET (Smith et al. 2022) |
| Transcript | Leaderless |
| Cysteines | 3 (the VapC4 method targets Cys codons) |
| Cross-validation | also detected by Ribo-RET (Smith et al. 2022) |
| H37Rv coordinates | 1524614–1524802 (+ strand) |
| Length | 62 amino acids |
Sequence
VLTIGAKRTLKVCIPQRGIERGLRYHKPALRIRNPHTEIFRKMQLLRCDRTKLSGGHDSPIC
Source: Troian EA et al., Nucleic Acids Res. 2026;54(7):gkag252 (doi:10.1093/nar/gkag252; PMC13096801); VapC4 ribosome-stalling proteogenomics. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins