ORF_65 microprotein

Intergenic (novel locus) existence proven (MS) function unknown 33 aa

A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown. It maps to an intergenic region (a genuinely novel locus, no overlapping CDS).

Evidence & coordinates

Detection methodVapC4 ribosome-stalling (5'-OH RNA-seq)
Existence evidenceVapC4 ribosome-stalling (5'-OH RNA-seq); MS-validated (ProteomeXchange PXD039671)
Cysteines2 (the VapC4 method targets Cys codons)
Cross-validationno Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5)
H37Rv coordinates2634124–2634225 (- strand)
Length33 amino acids

Sequence

MNKVLVKVRIFGVDCLTIRPWAGLCLESGRRSR

Source: Troian EA et al., Nucleic Acids Res. 2026;54(7):gkag252 (doi:10.1093/nar/gkag252; PMC13096801); VapC4 ribosome-stalling proteogenomics. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins