ORF_51 microprotein

Antisense to a gene existence proven (MS) function unknown 134 aa

A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown.

Evidence & coordinates

⚠ This ORF is now officially annotated as Rv2742A in H37Rv, but it is absent from this atlas's canonical gene set (it was added to the reference after this atlas was built). Listed here as a flagged gap.

Detection method	VapC4 ribosome-stalling (5'-OH RNA-seq)
Existence evidence	VapC4 ribosome-stalling (5'-OH RNA-seq); MS-validated (ProteomeXchange PXD003842, PXD008555, PXD010929, PXD011466, PXD012584, PXD013677, PXD025774, PXD035082, PXD050763, PXD060534, PXD065910, PXD071729, PXD071737); cross-validated by Ribo-RET (Smith et al. 2022)
Transcript	Leaderless
Cysteines	1 (the VapC4 method targets Cys codons)
Cross-validation	also detected by Ribo-RET (Smith et al. 2022)
H37Rv coordinates	3056019–3056423 (+ strand)
Length	134 amino acids

Sequence

MSDNAIRPRPNPWQYIRYCYGARLPDSMRDWVRNDLAGKGAAIRMMIRVAVPAVLVLAPFWLIPTSLDVHLSMTLPILIPFVYFSHALNKVWRRHMLRVHNLDPELVDEHARQRDAHIHRAYIERYGPRPDPND

Source: Troian EA et al., Nucleic Acids Res. 2026;54(7):gkag252 (doi:10.1093/nar/gkag252; PMC13096801); VapC4 ribosome-stalling proteogenomics. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins