ORF_38 microprotein
Antisense to a gene
existence proven (MS)
function unknown
76 aa
A non-canonical small protein (smORF) excluded from the H37Rv annotation, detected by proteogenomics with a high-confidence peptide-spectrum match. It is served here as part of a separate microproteome track: it is not one of the 3906 canonical genes and does not count in the dark stock. Its existence is proven; its molecular function is unknown.
Evidence & coordinates
| Detection method | VapC4 ribosome-stalling (5'-OH RNA-seq) |
|---|---|
| Existence evidence | VapC4 ribosome-stalling (5'-OH RNA-seq); MS-validated (ProteomeXchange PXD012584) |
| Cysteines | 2 (the VapC4 method targets Cys codons) |
| Cross-validation | no Ribo-RET footprint at this start (Smith et al. 2022). Not informative on its own: measured genome-wide, this Ribo-RET dataset recovers only 29.1 % of annotated H37Rv starts (1136/3906), so its absence here does not argue against this microprotein — existence is already established by the MS evidence above. (P20.5) |
| H37Rv coordinates | 3467784–3468014 (- strand) |
| Length | 76 amino acids |
Sequence
LRECRRTRVRFPAAPPKGQVGGPFADATAITDQGIVPRRVPPWPFGHGPDSRPDRRAHRRCRSSGSDPPGTVSLFP
Source: Troian EA et al., Nucleic Acids Res. 2026;54(7):gkag252 (doi:10.1093/nar/gkag252; PMC13096801); VapC4 ribosome-stalling proteogenomics. Overlap class is assigned by geometry against the H37Rv CDS set, not by the source's own label. ← all microproteins